eF-site ID 3dzu-A PDB Code 3dzu Chain A click to enlarge Title Intact PPAR gamma - RXR alpha Nuclear Receptor Complex on DNA bound with BVT.13, 9-cis Retinoic Acid and NCOA2 Peptide Classification Transcription/DNA Compound Retinoic acid receptor RXR-alpha Source null (3DZU) Sequence A:  KHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKDLTYTC RDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQR ANEDMPVERILEAELADPVTNICQAADKQLFTLVEWAKRI PHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILL ATGLHVHRNSAHSAGVGAIFDRVLTELVSKMRDMQMDKTE LGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKH KYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTP IDTFLMEML Description Functional site 1) chain A residue 135 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 2) chain A residue 138 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 3) chain A residue 152 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 4) chain A residue 155 type sequence C description BINDING SITE FOR RESIDUE ZN A 7221 source : AC3 5) chain A residue 171 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 6) chain A residue 177 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 7) chain A residue 187 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 8) chain A residue 190 type sequence C description BINDING SITE FOR RESIDUE ZN A 7222 source : AC4 9) chain A residue 268 type sequence I description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 10) chain A residue 271 type sequence A description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 11) chain A residue 272 type sequence A description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 12) chain A residue 275 type sequence Q description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 13) chain A residue 306 type sequence N description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 14) chain A residue 310 type sequence I description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 15) chain A residue 313 type sequence F description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 16) chain A residue 316 type sequence R description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 17) chain A residue 326 type sequence L description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 18) chain A residue 432 type sequence C description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 19) chain A residue 435 type sequence H description BINDING SITE FOR RESIDUE 9CR A 7223 source : AC5 20) chain A residue 171 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 21) chain A residue 177 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 22) chain A residue 187 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 23) chain A residue 190 type BINDING sequence C description BINDING => ECO:0000269|PubMed:9744270, ECO:0007744|PDB:2PRG source Swiss-Prot : SWS_FT_FI3 24) chain A residue 327 type MOD_RES sequence A description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI4 25) chain A residue 145 type MOD_RES sequence K description N6-acetyllysine; by EP300 => ECO:0000269|PubMed:17761950 source Swiss-Prot : SWS_FT_FI10 26) chain A residue 135-161 type prosite sequence CAICGDRSSGKHYGVYSCEGCKGFFKR description NUCLEAR_REC_DBD_1 Nuclear hormones receptors DNA-binding region signature. CrvCg.Dkasgf.HYgvhaCegCkgFFrR source prosite : PS00031

Display surface Download Links