eF-site ID 3dzi-A PDB Code 3dzi Chain A click to enlarge Title Crystal structure of human CD38 extracellular domain, ribose-5'-phosphate intermediate/GTP complex Classification HYDROLASE Compound ADP-ribosyl cyclase 1 Source Homo sapiens (Human) (CD38_HUMAN) Sequence A:  RWRQTWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQS VWDAFKGAFISKHPCDITEEDYQPLMKLGTQTVPCNKILL WSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFD TSKINYQSCPDWRKDCSNNPVSVFWKTVSRRFAEAACDVV HVMLDGSRSKIFDKDSTFGSVEVHNLQPEKVQTLEAWVIH GGREDSRDLCQDPTIKELESIISKRNIQFSCKNIYRPDKF LQCVKNPEDSSC Description Functional site 1) chain A residue 124 type sequence L description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 2) chain A residue 125 type sequence W description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 3) chain A residue 126 type sequence S description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 4) chain A residue 127 type sequence R description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 5) chain A residue 129 type sequence K description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 6) chain A residue 145 type sequence L description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 7) chain A residue 146 type sequence E description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 8) chain A residue 155 type sequence D description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 9) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 10) chain A residue 176 type sequence W description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 11) chain A residue 177 type sequence R description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 12) chain A residue 185 type sequence V description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 13) chain A residue 189 type sequence W description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 14) chain A residue 193 type sequence S description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 15) chain A residue 220 type sequence S description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 16) chain A residue 221 type sequence T description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 17) chain A residue 222 type sequence F description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 18) chain A residue 226 type sequence E description BINDING SITE FOR RESIDUE RGT A 301 source : AC2 19) chain A residue 164 type CARBOHYD sequence D description N-linked (GlcNAc...) asparagine => ECO:0000255 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 219 type CARBOHYD sequence D description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:19159218, ECO:0000269|PubMed:19349973 source Swiss-Prot : SWS_FT_FI4 21) chain A residue 119 type ACT_SITE sequence C description ACT_SITE => ECO:0000305|PubMed:7961800 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 201 type ACT_SITE sequence C description ACT_SITE => ECO:0000305|PubMed:7961800 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 100 type CARBOHYD sequence D description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:19159218 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 209 type CARBOHYD sequence D description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:19159218 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links