eF-site ID 3dr1-AB
PDB Code 3dr1
Chain A, B

click to enlarge
Title Side-chain fluorine atoms of non-steroidal vitamin D3 analogs stabilize helix 12 of vitamin D receptor
Classification GENE REGULATION/TRANSFERASE
Compound Vitamin D3 receptor A
Source Homo sapiens (Human) (NCOA1_HUMAN)
Sequence A:  SHMLSDEQMQIINSLVEAHHKTYDDSYSDFVRFRPPVRRL
SMLPHLADLVSYSIQKVIGFAKMIPGFRDLTAEDQIALLK
SSAIEIIMLRSNQSFSLEDMSWSCGGPDFKYCINDVTKAG
HTLELLEPLVKFQVGLKKLKLHEEEHVLLMAICLLSPDRP
GVQDHVRIEALQDRLCDVLQAYIRIQHPGGRLLYAKMIQK
LADLRSLNEEHSKQYRSLSFQPEHSMQLTPLVLEVFGSEV
B:  RHKILHRLLQE
Description (1)  Vitamin D3 receptor A, SRC-1 (LXXLL motif) from Nuclear receptor coactivator 1 (E.C.2.3.1.48)


Functional site

1) chain A
residue 175
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

2) chain A
residue 179
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

3) chain A
residue 255
type
ligand
sequence L
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

4) chain A
residue 265
type
ligand
sequence S
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

5) chain A
residue 302
type
ligand
sequence R
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

6) chain A
residue 303
type
ligand
sequence S
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

7) chain A
residue 306
type
ligand
sequence S
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

8) chain A
residue 316
type
ligand
sequence C
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

9) chain A
residue 331
type
ligand
sequence A
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

10) chain A
residue 333
type
ligand
sequence H
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

11) chain A
residue 341
type
ligand
sequence L
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

12) chain A
residue 423
type
ligand
sequence H
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

13) chain A
residue 427
type
ligand
sequence Y
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

14) chain A
residue 430
type
ligand
sequence L
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

15) chain A
residue 440
type
ligand
sequence L
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

16) chain A
residue 448
type
ligand
sequence F
description BINDING SITE FOR RESIDUE C5D A 500
source : AC1

17) chain A
residue 182
type BINDING
ligand
sequence F
description Vitamin D3.
source Swiss-Prot : SWS_FT_FI1

18) chain A
residue 272
type BINDING
ligand
sequence F
description Vitamin D3.
source Swiss-Prot : SWS_FT_FI1

19) chain A
residue 175
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence Y
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

20) chain A
residue 179
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence Y
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

21) chain A
residue 182
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence F
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

22) chain A
residue 255
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence L
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

23) chain A
residue 258-259
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence LA
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

24) chain A
residue 261-262
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence LV
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

25) chain A
residue 265
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence S
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

26) chain A
residue 296
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence I
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

27) chain A
residue 299-300
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence IM
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

28) chain A
residue 302-303
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence RS
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

29) chain A
residue 305-306
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence QS
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

30) chain A
residue 314
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence W
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

31) chain A
residue 316
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence C
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

32) chain A
residue 328
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence V
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

33) chain A
residue 331
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence A
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

34) chain A
residue 333
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence H
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

35) chain A
residue 338
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence L
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

36) chain A
residue 341
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence L
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

37) chain A
residue 423
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence H
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

38) chain A
residue 427
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence Y
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

39) chain A
residue 430
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence L
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

40) chain A
residue 440
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence L
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

41) chain A
residue 444
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence V
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500

42) chain A
residue 448
type binding
ligand C5D: (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL
sequence F
description (1R,3R)-5-[(2E)-3-{(1S,3R)-2,2,3-TRIMETHYL-3-[6,6,6-TRIFLUORO-5-HYDROXY-5-(TRIFLUOROMETHYL)HEX-3-YN-1-YL]CYCLOPENTYL}PROP-2-EN-1-YLIDENE]CYCLOHEXANE-1,3-DIOL binding site
source pdb_hetatom : C5D_3dr1_A_500


Display surface

Download
Links