eF-site ID 3dkd-A PDB Code 3dkd Chain A click to enlarge Title Crystal structure of the mimivirus NDK +Kpn-N62L-R107G triple mutant complexed with GDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source null (NDK_MIMIV) Sequence A:  LQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWSK APRNLIEQHYKEHSEQSYFNDLCDFMVSGPIISIVYEGTD AISKIRRLQGNTNPLASAPGTIRGDLANDIGENLIHASDS EDSAVDEISIWFP Description Functional site 1) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 2) chain A residue 50 type sequence Y description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 3) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 4) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 5) chain A residue 62 type sequence L description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 6) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 7) chain A residue 92 type sequence T description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 8) chain A residue 103 type sequence R description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 9) chain A residue 110 type sequence I description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 10) chain A residue 111 type sequence G description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 11) chain A residue 113 type sequence N description BINDING SITE FOR RESIDUE GDP A 143 source : AC3 12) chain A residue 113-121 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 13) chain A residue 116 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 103 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 18) chain A residue 113 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links