eF-site ID 3d2r-A PDB Code 3d2r Chain A click to enlarge Title Crystal structure of pyruvate dehydrogenase kinase isoform 4 in complex with ADP Classification TRANSFERASE Compound [Pyruvate dehydrogenase [lipoamide]] kinase isozyme 4 Source Homo sapiens (Human) (PDK4_HUMAN) Sequence A:  PREVEHFSRYSPSPLSMKQLLDFGSENCERTSFAFLRQEL PVRLANILKEIDILPTQLVNTSSVQLVKSWYIQSLMDLVE FHEKSPDDQKALSDFVDTLIKVRNRHHNVVPTMAQGIIEY KDACDPVTNQNLQYFLDRFYMNRISTRMLMNQHILIFSDS HIGSIDPNCDVVAVVQDAFECSRMLCDQYYLSSPELKLTQ VNGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQEN QPSLTPIEVIVVLGKEDLTIKISDRGGGVPLRIIDRLFSY TYSTAPTAPLAGFGYGLPISRLYAKYFQGDLNLYSLSGYG TDAIIYLKALSSESIEKLPVFNKSAFKHYDDWCI Description Functional site 1) chain A residue 258 type sequence N description BINDING SITE FOR RESIDUE MG A 500 source : AC1 2) chain A residue 258 type sequence N description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 3) chain A residue 261 type sequence R description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 4) chain A residue 262 type sequence A description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 5) chain A residue 293 type sequence D description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 6) chain A residue 306 type sequence L description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 7) chain A residue 311 type sequence Y description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 8) chain A residue 312 type sequence S description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 9) chain A residue 313 type sequence T description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 10) chain A residue 328 type sequence A description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 11) chain A residue 329 type sequence G description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 12) chain A residue 330 type sequence F description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 13) chain A residue 331 type sequence G description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 14) chain A residue 333 type sequence G description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 15) chain A residue 334 type sequence L description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 16) chain A residue 358 type sequence T description BINDING SITE FOR RESIDUE ADP A 501 source : AC3 17) chain A residue 160 type sequence D description BINDING SITE FOR RESIDUE GOL A 502 source : AC5 18) chain A residue 342 type sequence K description BINDING SITE FOR RESIDUE GOL A 502 source : AC5 19) chain A residue 374 type sequence K description BINDING SITE FOR RESIDUE GOL A 502 source : AC5 20) chain A residue 395 type sequence W description BINDING SITE FOR RESIDUE GOL B 502 source : AC6 21) chain A residue 254 type BINDING sequence E description BINDING => ECO:0000269|PubMed:18658136 source Swiss-Prot : SWS_FT_FI1 22) chain A residue 293 type BINDING sequence D description BINDING => ECO:0000269|PubMed:18658136 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 312 type BINDING sequence S description BINDING => ECO:0000269|PubMed:18658136 source Swiss-Prot : SWS_FT_FI1 24) chain A residue 329 type BINDING sequence G description BINDING => ECO:0000269|PubMed:18658136 source Swiss-Prot : SWS_FT_FI1 25) chain A residue 157 type SITE sequence Y description Interaction with the other subunit in the homodimer source Swiss-Prot : SWS_FT_FI2 26) chain A residue 161 type SITE sequence R description Interaction with the other subunit in the homodimer source Swiss-Prot : SWS_FT_FI2 27) chain A residue 395 type SITE sequence W description Interaction with the other subunit in the homodimer source Swiss-Prot : SWS_FT_FI2

Display surface Download Links