eF-site ID 3d22-A PDB Code 3d22 Chain A click to enlarge Title Crystal structure of a poplar thioredoxin h mutant, PtTrxh4C61S Classification OXIDOREDUCTASE Compound Thioredoxin H-type Source Populus jackii (Balm of Gilead) (Populus deltoides x Populus balsamifera) (TRXH_POPJC) Sequence A:  GLCLAEPHIELAGGNVHLITTKERWDQKLSEASRDGKIVL ANFSARWCGPSRQIAPYYIELSENYPSLMFLVIDVDELSD FSASWEIKATPTFFFLRDGQQVDKLVGANKPELHKKITAI LDSLPPSDK Description Functional site 1) chain A residue 18 type sequence H description BINDING SITE FOR RESIDUE PO4 A 140 source : AC1 2) chain A residue 27 type sequence H description BINDING SITE FOR RESIDUE PO4 A 140 source : AC1 3) chain A residue 34 type sequence R description BINDING SITE FOR RESIDUE PO4 A 140 source : AC1 4) chain A residue 58 type ACT_SITE sequence C description Nucleophile => ECO:0000250|UniProtKB:P10599 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 61 type ACT_SITE sequence S description Nucleophile => ECO:0000250|UniProtKB:P10599 source Swiss-Prot : SWS_FT_FI1 6) chain A residue 59 type SITE sequence G description Contributes to redox potential value => ECO:0000250|UniProtKB:P10599 source Swiss-Prot : SWS_FT_FI2 7) chain A residue 60 type SITE sequence P description Contributes to redox potential value => ECO:0000250|UniProtKB:P10599 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links