eF-site ID 3cwk-A PDB Code 3cwk Chain A click to enlarge Title Crystal Structure of the R132K:Y134F:R111L:T54V:L121E Mutant of Cellular Retinoic Acid Binding Protein Type II in Complex with All-trans-Retinoic Acid at 1.57 Angstroms Resolution Classification TRANSPORT PROTEIN Compound Cellular retinoic acid-binding protein 2 Source Homo sapiens (Human) (RABP2_HUMAN) Sequence A:  PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKPA VEIKQEGDTFYIKVSTTVRTTEINFKVGEEFEEQTVDGRP CKSLVKWESENKMVCEQKLLKGEGPKTSWTLELTNDGELI ETMTADDVVCTKVFVRE Description Functional site 1) chain A residue 86 type sequence K description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 2) chain A residue 113 type sequence L description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 3) chain A residue 114 type sequence T description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 4) chain A residue 115 type sequence N description BINDING SITE FOR RESIDUE SO4 A 400 source : AC1 5) chain A residue 13 type sequence E description BINDING SITE FOR RESIDUE REA A 300 source : AC2 6) chain A residue 19 type sequence L description BINDING SITE FOR RESIDUE REA A 300 source : AC2 7) chain A residue 32 type sequence A description BINDING SITE FOR RESIDUE REA A 300 source : AC2 8) chain A residue 121 type sequence E description BINDING SITE FOR RESIDUE REA A 300 source : AC2 9) chain A residue 132 type sequence K description BINDING SITE FOR RESIDUE REA A 300 source : AC2 10) chain A residue 5-22 type prosite sequence GNWKIIRSENFEELLKVL description FABP Cytosolic fatty-acid binding proteins signature. GNWkIirSeNFEeLLKVL source prosite : PS00214 11) chain A residue 132 type BINDING sequence K description BINDING => ECO:0000269|PubMed:16979656, ECO:0007744|PDB:2FR3 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 101 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO) => ECO:0000269|PubMed:21998312 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links