eF-site ID 3cvd-A PDB Code 3cvd Chain A click to enlarge Title Regulation of Protein Function: Crystal Packing Interfaces and Conformational Dimerization Classification ELECTRON TRANSPORT Compound Plastocyanin Source null (PLAS_PHOLA) Sequence A:  ETFTVKMGADSGLFQFEPANVTVHPGDTVKWVNNKLPPHN ILFDDKQVPGASKELADKLSHSQLMFSPGESYEITFSSDF PAGTYTYYCAPHRGAGMVGKITVE Description Functional site 1) chain A residue 38 type sequence P description BINDING SITE FOR RESIDUE CU1 A 106 source : AC1 2) chain A residue 39 type sequence H description BINDING SITE FOR RESIDUE CU1 A 106 source : AC1 3) chain A residue 89 type sequence C description BINDING SITE FOR RESIDUE CU1 A 106 source : AC1 4) chain A residue 92 type sequence H description BINDING SITE FOR RESIDUE CU1 A 106 source : AC1 5) chain A residue 97 type sequence M description BINDING SITE FOR RESIDUE CU1 A 106 source : AC1 6) chain A residue 44 type sequence D description BINDING SITE FOR RESIDUE ZN A 107 source : AC2 7) chain A residue 45 type sequence D description BINDING SITE FOR RESIDUE ZN A 107 source : AC2 8) chain A residue 24 type sequence H description BINDING SITE FOR RESIDUE ZN A 108 source : AC3 9) chain A residue 61 type sequence H description BINDING SITE FOR RESIDUE ZN C 106 source : AC5 10) chain A residue 39 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10089349 source Swiss-Prot : SWS_FT_FI1 11) chain A residue 89 type BINDING sequence C description BINDING => ECO:0000269|PubMed:10089349 source Swiss-Prot : SWS_FT_FI1 12) chain A residue 92 type BINDING sequence H description BINDING => ECO:0000269|PubMed:10089349 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 97 type BINDING sequence M description BINDING => ECO:0000269|PubMed:10089349 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 82-97 type prosite sequence AGTYTYYCAPHRGAGM description COPPER_BLUE Type-1 copper (blue) proteins signature. AgtYtYYCa.P.HrgagM source prosite : PS00196

Display surface Download Links