eF-site ID 3ctf-A PDB Code 3ctf Chain A click to enlarge Title Crystal structure of oxidized GRX2 Classification OXIDOREDUCTASE Compound Glutaredoxin-2 Source null (GLRX2_YEAST) Sequence A:  VSQETVAHVKDLIGQKEVFVAAKTYCPYCKATLSTLFQEL NVPKSKALVLELDEMSNGSEIQDALEEISGQKTVPNVYIN GKHIGGNSDLETLKKNGKLAEILKPVFQ Description Functional site 1) chain A residue 91 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956, ECO:0007744|PubMed:19779198 source Swiss-Prot : SWS_FT_FI4 2) chain A residue 58 type BINDING sequence K description BINDING => ECO:0000269|PubMed:18992757 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 109 type BINDING sequence V description BINDING => ECO:0000269|PubMed:18992757 source Swiss-Prot : SWS_FT_FI1 4) chain A residue 122 type BINDING sequence N description BINDING => ECO:0000269|PubMed:18992757 source Swiss-Prot : SWS_FT_FI1 5) chain A residue 37 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18407956 source Swiss-Prot : SWS_FT_FI2 6) chain A residue 61 type MOD_RES sequence C description S-glutathionyl cysteine; alternate => ECO:0000269|PubMed:18992757 source Swiss-Prot : SWS_FT_FI3 7) chain A residue 55-71 type prosite sequence VAAKTYCPYCKATLSTL description GLUTAREDOXIN_1 Glutaredoxin active site. VAaktyCPYCkaTlstL source prosite : PS00195

Display surface Download Links