eF-site ID 3co7-C PDB Code 3co7 Chain C click to enlarge Title Crystal Structure of FoxO1 DBD Bound to DBE2 DNA Classification Transcription/DNA Compound DNA (5'-D(*DTP*DCP*DTP*DTP*DGP*DTP*DTP*DTP*DAP*DCP*DAP*DTP*DTP*DTP*DTP*DG)-3') Source Homo sapiens (Human) (3CO7) Sequence C:  SRRNAWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSV PYFKDKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKS SWWMLNP Description Functional site 1) chain C residue 159-235 type DNA_BIND sequence AWGNLSYADLITKAIESSAEKRLTLSQIYEWMVKSVPYFK DKGDSNSSAGWKNSIRHNLSLHSKFIRVQNEGTGKSS description Fork-head => ECO:0000255|PROSITE-ProRule:PRU00089 source Swiss-Prot : SWS_FT_FI1 2) chain C residue 209-215 type prosite sequence WKNSIRH description FORK_HEAD_2 Fork head domain signature 2. WKNSIRH source prosite : PS00658 3) chain C residue 158 type SITE sequence N description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 4) chain C residue 165 type SITE sequence Y description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 5) chain C residue 225 type SITE sequence R description DNA-binding => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI2 6) chain C residue 212 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403, ECO:0000269|PubMed:19221179, ECO:0000269|PubMed:21245099 source Swiss-Prot : SWS_FT_FI3 7) chain C residue 218 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 8) chain C residue 234 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4 9) chain C residue 235 type MOD_RES sequence S description Phosphoserine; by STK4/MST1 => ECO:0000269|PubMed:18786403 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links