eF-site ID 3cmc-OPQR PDB Code 3cmc Chain O, P, Q, R click to enlarge Title Thioacylenzyme intermediate of Bacillus stearothermophilus phosphorylating GAPDH Classification OXIDOREDUCTASE Compound Glyceraldehyde-3-phosphate dehydrogenase Source Geobacillus stearothermophilus (Bacillus stearothermophilus) (G3P_BACST) Sequence O:  AVKVGINGFGRIGRNVFRAALKNPDIEVVAVNDLTDANTL AHLLKYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPE NLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISA PAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFA KVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAA AESIIPTTTGAAKAVALVLPELKGKLNGMAMRVPTPNVSV VDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLV SRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYDNETGYSH RVVDLAAYIASKGL P:  AVKVGINGFGRIGRNVFRAALKNPDIEVVAVNDLTDANTL AHLLKYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPE NLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISA PAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFA KVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAA AESIIPTTTGAAKAVALVLPELKGKLNGMAMRVPTPNVSV VDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLV SRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYDNETGYSH RVVDLAAYIASKGL Q:  AVKVGINGFGRIGRNVFRAALKNPDIEVVAVNDLTDANTL AHLLKYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPE NLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISA PAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFA KVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAA AESIIPTTTGAAKAVALVLPELKGKLNGMAMRVPTPNVSV VDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLV SRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYDNETGYSH RVVDLAAYIASKGL R:  AVKVGINGFGRIGRNVFRAALKNPDIEVVAVNDLTDANTL AHLLKYDSVHGRLDAEVSVNGNNLVVNGKEIIVKAERDPE NLAWGEIGVDIVVESTGRFTKREDAAKHLEAGAKKVIISA PAKNEDITIVMGVNQDKYDPKAHHVISNASCTTNCLAPFA KVLHEQFGIVRGMMTTVHSYTNDQRILDLPHKDLRRARAA AESIIPTTTGAAKAVALVLPELKGKLNGMAMRVPTPNVSV VDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLV SRDYNGSTVSSTIDALSTMVIDGKMVKVVSWYDNETGYSH RVVDLAAYIASKGL Description (1)  Glyceraldehyde-3-phosphate dehydrogenase (E.C.1.2.1.12) Functional site 1) chain O residue 148 type sequence S description BINDING SITE FOR RESIDUE SO4 O 401 source : AC1 2) chain O residue 207 type sequence T description BINDING SITE FOR RESIDUE SO4 O 401 source : AC1 3) chain O residue 208 type sequence T description BINDING SITE FOR RESIDUE SO4 O 401 source : AC1 4) chain O residue 209 type sequence G description BINDING SITE FOR RESIDUE SO4 O 401 source : AC1 5) chain O residue 210 type sequence A description BINDING SITE FOR RESIDUE SO4 O 401 source : AC1 6) chain P residue 121 type sequence P description BINDING SITE FOR RESIDUE SO4 P 401 source : AC2 7) chain P residue 148 type sequence S description BINDING SITE FOR RESIDUE SO4 P 401 source : AC2 8) chain P residue 207 type sequence T description BINDING SITE FOR RESIDUE SO4 P 401 source : AC2 9) chain P residue 208 type sequence T description BINDING SITE FOR RESIDUE SO4 P 401 source : AC2 10) chain P residue 209 type sequence G description BINDING SITE FOR RESIDUE SO4 P 401 source : AC2 11) chain P residue 210 type sequence A description BINDING SITE FOR RESIDUE SO4 P 401 source : AC2 12) chain Q residue 121 type sequence P description BINDING SITE FOR RESIDUE SO4 Q 401 source : AC3 13) chain Q residue 148 type sequence S description BINDING SITE FOR RESIDUE SO4 Q 401 source : AC3 14) chain Q residue 207 type sequence T description BINDING SITE FOR RESIDUE SO4 Q 401 source : AC3 15) chain Q residue 208 type sequence T description BINDING SITE FOR RESIDUE SO4 Q 401 source : AC3 16) chain Q residue 209 type sequence G description BINDING SITE FOR RESIDUE SO4 Q 401 source : AC3 17) chain Q residue 210 type sequence A description BINDING SITE FOR RESIDUE SO4 Q 401 source : AC3 18) chain R residue 148 type sequence S description BINDING SITE FOR RESIDUE SO4 R 401 source : AC4 19) chain R residue 207 type sequence T description BINDING SITE FOR RESIDUE SO4 R 401 source : AC4 20) chain R residue 208 type sequence T description BINDING SITE FOR RESIDUE SO4 R 401 source : AC4 21) chain R residue 209 type sequence G description BINDING SITE FOR RESIDUE SO4 R 401 source : AC4 22) chain R residue 210 type sequence A description BINDING SITE FOR RESIDUE SO4 R 401 source : AC4 23) chain O residue 179 type sequence T description BINDING SITE FOR RESIDUE SO4 O 402 source : AC5 24) chain O residue 181 type sequence D description BINDING SITE FOR RESIDUE SO4 O 402 source : AC5 25) chain O residue 195 type sequence R description BINDING SITE FOR RESIDUE SO4 O 402 source : AC5 26) chain O residue 231 type sequence R description BINDING SITE FOR RESIDUE SO4 O 402 source : AC5 27) chain P residue 179 type sequence T description BINDING SITE FOR RESIDUE SO4 P 402 source : AC6 28) chain P residue 181 type sequence D description BINDING SITE FOR RESIDUE SO4 P 402 source : AC6 29) chain P residue 195 type sequence R description BINDING SITE FOR RESIDUE SO4 P 402 source : AC6 30) chain P residue 231 type sequence R description BINDING SITE FOR RESIDUE SO4 P 402 source : AC6 31) chain Q residue 179 type sequence T description BINDING SITE FOR RESIDUE SO4 Q 402 source : AC7 32) chain Q residue 181 type sequence D description BINDING SITE FOR RESIDUE SO4 Q 402 source : AC7 33) chain Q residue 195 type sequence R description BINDING SITE FOR RESIDUE SO4 Q 402 source : AC7 34) chain Q residue 231 type sequence R description BINDING SITE FOR RESIDUE SO4 Q 402 source : AC7 35) chain R residue 179 type sequence T description BINDING SITE FOR RESIDUE SO4 R 402 source : AC8 36) chain R residue 181 type sequence D description BINDING SITE FOR RESIDUE SO4 R 402 source : AC8 37) chain R residue 195 type sequence R description BINDING SITE FOR RESIDUE SO4 R 402 source : AC8 38) chain R residue 231 type sequence R description BINDING SITE FOR RESIDUE SO4 R 402 source : AC8 39) chain O residue 169 type sequence R description BINDING SITE FOR RESIDUE SO4 O 403 source : AC9 40) chain P residue 303 type sequence K description BINDING SITE FOR RESIDUE SO4 O 403 source : AC9 41) chain O residue 183 type sequence R description BINDING SITE FOR RESIDUE SO4 O 404 source : BC1 42) chain O residue 190 type sequence H description BINDING SITE FOR RESIDUE SO4 O 404 source : BC1 43) chain O residue 191 type sequence K description BINDING SITE FOR RESIDUE SO4 O 404 source : BC1 44) chain Q residue 303 type sequence K description BINDING SITE FOR RESIDUE SO4 R 403 source : BC2 45) chain R residue 169 type sequence R description BINDING SITE FOR RESIDUE SO4 R 403 source : BC2 46) chain Q residue 183 type sequence R description BINDING SITE FOR RESIDUE SO4 Q 403 source : BC3 47) chain Q residue 188 type sequence P description BINDING SITE FOR RESIDUE SO4 Q 403 source : BC3 48) chain Q residue 190 type sequence H description BINDING SITE FOR RESIDUE SO4 Q 403 source : BC3 49) chain Q residue 191 type sequence K description BINDING SITE FOR RESIDUE SO4 Q 403 source : BC3 50) chain R residue 52 type sequence R description BINDING SITE FOR RESIDUE SO4 R 404 source : BC4 51) chain R residue 58 type sequence S description BINDING SITE FOR RESIDUE SO4 R 405 source : BC5 52) chain O residue 62 type sequence N description BINDING SITE FOR RESIDUE SO4 O 405 source : BC6 53) chain O residue 63 type sequence N description BINDING SITE FOR RESIDUE SO4 O 405 source : BC6 54) chain R residue 183 type sequence R description BINDING SITE FOR RESIDUE SO4 R 406 source : BC7 55) chain R residue 190 type sequence H description BINDING SITE FOR RESIDUE SO4 R 406 source : BC7 56) chain R residue 191 type sequence K description BINDING SITE FOR RESIDUE SO4 R 406 source : BC7 57) chain P residue 138 type sequence D description BINDING SITE FOR RESIDUE SO4 R 407 source : BC8 58) chain P residue 139 type sequence K description BINDING SITE FOR RESIDUE SO4 R 407 source : BC8 59) chain R residue 109 type sequence L description BINDING SITE FOR RESIDUE SO4 R 407 source : BC8 60) chain R residue 112 type sequence G description BINDING SITE FOR RESIDUE SO4 R 407 source : BC8 61) chain R residue 113 type sequence A description BINDING SITE FOR RESIDUE SO4 R 407 source : BC8 62) chain R residue 114 type sequence K description BINDING SITE FOR RESIDUE SO4 R 407 source : BC8 63) chain O residue 85 type sequence G description BINDING SITE FOR RESIDUE SO4 O 406 source : BC9 64) chain O residue 111 type sequence A description BINDING SITE FOR RESIDUE SO4 O 406 source : BC9 65) chain O residue 112 type sequence G description BINDING SITE FOR RESIDUE SO4 O 406 source : BC9 66) chain O residue 148 type sequence S description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 67) chain O residue 149 type sequence C description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 68) chain O residue 150 type sequence T description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 69) chain O residue 176 type sequence H description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 70) chain O residue 179 type sequence T description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 71) chain O residue 208 type sequence T description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 72) chain O residue 209 type sequence G description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 73) chain O residue 231 type sequence R description BINDING SITE FOR RESIDUE G3H O 400 source : CC1 74) chain P residue 148 type sequence S description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 75) chain P residue 149 type sequence C description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 76) chain P residue 150 type sequence T description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 77) chain P residue 176 type sequence H description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 78) chain P residue 208 type sequence T description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 79) chain P residue 209 type sequence G description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 80) chain P residue 231 type sequence R description BINDING SITE FOR RESIDUE G3H P 400 source : CC2 81) chain Q residue 148 type sequence S description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 82) chain Q residue 149 type sequence C description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 83) chain Q residue 150 type sequence T description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 84) chain Q residue 176 type sequence H description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 85) chain Q residue 179 type sequence T description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 86) chain Q residue 208 type sequence T description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 87) chain Q residue 209 type sequence G description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 88) chain Q residue 231 type sequence R description BINDING SITE FOR RESIDUE G3H Q 400 source : CC3 89) chain R residue 148 type sequence S description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 90) chain R residue 149 type sequence C description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 91) chain R residue 150 type sequence T description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 92) chain R residue 176 type sequence H description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 93) chain R residue 179 type sequence T description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 94) chain R residue 208 type sequence T description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 95) chain R residue 209 type sequence G description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 96) chain R residue 231 type sequence R description BINDING SITE FOR RESIDUE G3H R 400 source : CC4 97) chain O residue 7 type sequence G description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 98) chain O residue 9 type sequence G description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 99) chain O residue 10 type sequence R description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 100) chain O residue 11 type sequence I description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 101) chain O residue 31 type sequence N description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 102) chain O residue 32 type sequence D description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 103) chain O residue 33 type sequence L description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 104) chain O residue 77 type sequence R description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 105) chain O residue 95 type sequence S description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 106) chain O residue 96 type sequence T description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 107) chain O residue 97 type sequence G description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 108) chain O residue 98 type sequence R description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 109) chain O residue 99 type sequence F description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 110) chain O residue 119 type sequence S description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 111) chain O residue 120 type sequence A description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 112) chain O residue 180 type sequence N description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 113) chain O residue 313 type sequence N description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 114) chain O residue 317 type sequence Y description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 115) chain R residue 187 type sequence L description BINDING SITE FOR RESIDUE NAD O 407 source : CC5 116) chain P residue 7 type sequence G description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 117) chain P residue 9 type sequence G description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 118) chain P residue 10 type sequence R description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 119) chain P residue 11 type sequence I description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 120) chain P residue 31 type sequence N description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 121) chain P residue 32 type sequence D description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 122) chain P residue 33 type sequence L description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 123) chain P residue 77 type sequence R description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 124) chain P residue 95 type sequence S description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 125) chain P residue 96 type sequence T description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 126) chain P residue 97 type sequence G description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 127) chain P residue 119 type sequence S description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 128) chain P residue 120 type sequence A description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 129) chain P residue 180 type sequence N description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 130) chain P residue 313 type sequence N description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 131) chain P residue 317 type sequence Y description BINDING SITE FOR RESIDUE NAD P 403 source : CC6 132) chain Q residue 7 type sequence G description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 133) chain Q residue 9 type sequence G description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 134) chain Q residue 10 type sequence R description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 135) chain Q residue 11 type sequence I description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 136) chain Q residue 31 type sequence N description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 137) chain Q residue 32 type sequence D description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 138) chain Q residue 33 type sequence L description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 139) chain Q residue 77 type sequence R description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 140) chain Q residue 95 type sequence S description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 141) chain Q residue 96 type sequence T description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 142) chain Q residue 97 type sequence G description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 143) chain Q residue 98 type sequence R description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 144) chain Q residue 99 type sequence F description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 145) chain Q residue 119 type sequence S description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 146) chain Q residue 120 type sequence A description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 147) chain Q residue 180 type sequence N description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 148) chain Q residue 313 type sequence N description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 149) chain Q residue 317 type sequence Y description BINDING SITE FOR RESIDUE NAD Q 404 source : CC7 150) chain R residue 7 type sequence G description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 151) chain R residue 9 type sequence G description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 152) chain R residue 10 type sequence R description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 153) chain R residue 11 type sequence I description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 154) chain R residue 31 type sequence N description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 155) chain R residue 32 type sequence D description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 156) chain R residue 33 type sequence L description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 157) chain R residue 77 type sequence R description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 158) chain R residue 95 type sequence S description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 159) chain R residue 96 type sequence T description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 160) chain R residue 97 type sequence G description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 161) chain R residue 98 type sequence R description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 162) chain R residue 99 type sequence F description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 163) chain R residue 119 type sequence S description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 164) chain R residue 120 type sequence A description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 165) chain R residue 180 type sequence N description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 166) chain R residue 313 type sequence N description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 167) chain R residue 317 type sequence Y description BINDING SITE FOR RESIDUE NAD R 408 source : CC8 168) chain Q residue 134 type sequence Q description BINDING SITE FOR RESIDUE EDO Q 405 source : CC9 169) chain Q residue 135 type sequence D description BINDING SITE FOR RESIDUE EDO Q 405 source : CC9 170) chain Q residue 159 type sequence K description BINDING SITE FOR RESIDUE EDO Q 405 source : CC9 171) chain Q residue 169 type sequence R description BINDING SITE FOR RESIDUE GOL R 409 source : DC1 172) chain R residue 303 type sequence K description BINDING SITE FOR RESIDUE GOL R 409 source : DC1 173) chain P residue 131 type sequence G description BINDING SITE FOR RESIDUE GOL P 404 source : DC2 174) chain P residue 134 type sequence Q description BINDING SITE FOR RESIDUE GOL P 404 source : DC2 175) chain P residue 135 type sequence D description BINDING SITE FOR RESIDUE GOL P 404 source : DC2 176) chain P residue 159 type sequence K description BINDING SITE FOR RESIDUE GOL P 404 source : DC2 177) chain P residue 181 type sequence D description BINDING SITE FOR RESIDUE GOL P 405 source : DC3 178) chain P residue 183 type sequence R description BINDING SITE FOR RESIDUE GOL P 405 source : DC3 179) chain P residue 188 type sequence P description BINDING SITE FOR RESIDUE GOL P 405 source : DC3 180) chain P residue 190 type sequence H description BINDING SITE FOR RESIDUE GOL P 405 source : DC3 181) chain P residue 191 type sequence K description BINDING SITE FOR RESIDUE GOL P 405 source : DC3 182) chain O residue 303 type sequence K description BINDING SITE FOR RESIDUE GOL O 408 source : DC4 183) chain P residue 169 type sequence R description BINDING SITE FOR RESIDUE GOL O 408 source : DC4 184) chain R residue 134 type sequence Q description BINDING SITE FOR RESIDUE GOL R 410 source : DC5 185) chain R residue 135 type sequence D description BINDING SITE FOR RESIDUE GOL R 410 source : DC5 186) chain P residue 212 type sequence K description BINDING SITE FOR RESIDUE GOL P 406 source : DC6 187) chain P residue 215 type sequence A description BINDING SITE FOR RESIDUE GOL P 406 source : DC6 188) chain P residue 223 type sequence G description BINDING SITE FOR RESIDUE GOL P 406 source : DC6 189) chain Q residue 14 type sequence N description BINDING SITE FOR RESIDUE GOL Q 406 source : DC7 190) chain Q residue 17 type sequence R description BINDING SITE FOR RESIDUE GOL Q 406 source : DC7 191) chain Q residue 50 type sequence H description BINDING SITE FOR RESIDUE GOL Q 406 source : DC7 192) chain Q residue 315 type sequence T description BINDING SITE FOR RESIDUE GOL Q 406 source : DC7 193) chain P residue 50 type sequence H description BINDING SITE FOR RESIDUE GOL P 407 source : DC8 194) chain P residue 51 type sequence G description BINDING SITE FOR RESIDUE GOL P 407 source : DC8 195) chain R residue 281 type sequence R description BINDING SITE FOR RESIDUE GOL P 407 source : DC8 196) chain O residue 147-154 type prosite sequence ASCTTNCL description GAPDH Glyceraldehyde 3-phosphate dehydrogenase active site. ASCTTNcL source prosite : PS00071 197) chain O residue 149 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:18480053, ECO:0000305|PubMed:12569100 source Swiss-Prot : SWS_FT_FI1 198) chain P residue 149 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:18480053, ECO:0000305|PubMed:12569100 source Swiss-Prot : SWS_FT_FI1 199) chain Q residue 149 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:18480053, ECO:0000305|PubMed:12569100 source Swiss-Prot : SWS_FT_FI1 200) chain R residue 149 type ACT_SITE sequence C description Nucleophile => ECO:0000269|PubMed:18480053, ECO:0000305|PubMed:12569100 source Swiss-Prot : SWS_FT_FI1 201) chain O residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 202) chain P residue 119 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 203) chain P residue 180 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 204) chain P residue 313 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 205) chain Q residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 206) chain Q residue 32 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 207) chain Q residue 77 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 208) chain Q residue 119 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 209) chain Q residue 180 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 210) chain Q residue 313 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 211) chain R residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 212) chain O residue 32 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 213) chain R residue 32 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 214) chain R residue 77 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 215) chain R residue 119 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 216) chain R residue 180 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 217) chain R residue 313 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 218) chain O residue 77 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 219) chain O residue 119 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 220) chain O residue 180 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 221) chain O residue 313 type BINDING sequence N description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 222) chain P residue 10 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 223) chain P residue 32 type BINDING sequence D description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 224) chain P residue 77 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI2 225) chain O residue 148 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 226) chain R residue 148 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 227) chain R residue 179 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 228) chain R residue 231 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 229) chain O residue 179 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 230) chain O residue 231 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 231) chain P residue 148 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 232) chain P residue 179 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 233) chain P residue 231 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 234) chain Q residue 148 type BINDING sequence S description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 235) chain Q residue 179 type BINDING sequence T description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 236) chain Q residue 231 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI3 237) chain O residue 195 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI4 238) chain P residue 195 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI4 239) chain Q residue 195 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI4 240) chain R residue 195 type BINDING sequence R description BINDING => ECO:0000269|PubMed:12569100, ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI4 241) chain O residue 208 type BINDING sequence T description BINDING => ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI5 242) chain P residue 208 type BINDING sequence T description BINDING => ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI5 243) chain Q residue 208 type BINDING sequence T description BINDING => ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI5 244) chain R residue 208 type BINDING sequence T description BINDING => ECO:0000269|PubMed:18480053, ECO:0000269|PubMed:3210237, ECO:0000269|PubMed:3586018, ECO:0000269|PubMed:9175858 source Swiss-Prot : SWS_FT_FI5 245) chain O residue 176 type SITE sequence H description Activates thiol group during catalysis => ECO:0000250|UniProtKB:Q6GIL8 source Swiss-Prot : SWS_FT_FI6 246) chain P residue 176 type SITE sequence H description Activates thiol group during catalysis => ECO:0000250|UniProtKB:Q6GIL8 source Swiss-Prot : SWS_FT_FI6 247) chain Q residue 176 type SITE sequence H description Activates thiol group during catalysis => ECO:0000250|UniProtKB:Q6GIL8 source Swiss-Prot : SWS_FT_FI6 248) chain R residue 176 type SITE sequence H description Activates thiol group during catalysis => ECO:0000250|UniProtKB:Q6GIL8 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links