eF-site ID 3ced-A PDB Code 3ced Chain A click to enlarge Title Crystal structure of the C-terminal NIL domain of an ABC transporter protein homologue from Staphylococcus aureus Classification HYDROLASE Compound Methionine import ATP-binding protein metN 2 Source Staphylococcus aureus (strain Mu50 / ATCC 700699) (METN2_STAAM) Sequence A:  SNADDFETSLTELEPLEKDAYIVRLVFAGSTTTEPIVSSL STAYDIKINILEANIKNTKNGTVGFLVLHIPYISSVDFGK FEKELIERQVKXEVLRHG Description (1)  Methionine import ATP-binding protein metN 2 (E.C.3.6.3.-) Functional site 1) chain A residue 320 type sequence D description BINDING SITE FOR RESIDUE BU1 A 402 source : AC2 2) chain A residue 292 type sequence N description BINDING SITE FOR RESIDUE BU1 A 403 source : AC3 3) chain A residue 312 type sequence H description BINDING SITE FOR RESIDUE BU1 A 403 source : AC3

Display surface Download Links