eF-site ID 3c75-A PDB Code 3c75 Chain A click to enlarge Title Paracoccus versutus methylamine dehydrogenase in complex with amicyanin Classification OXIDOREDUCTASE Compound Methylamine dehydrogenase heavy chain Source ORGANISM_SCIENTIFIC: Paracoccus versutus; Sequence A:  QDKITVTSEKPVAAADVPADAVVVGIEKMKYLTPEVTIKA GETVYWVNGEVMPHNVAFKKGIVGEDAFRGEMMTKDQAYA ITFNEAGSYDYFCTPHPFMRGKVIVE Description (1)  Methylamine dehydrogenase heavy chain (E.C.1.4.99.3), Methylamine dehydrogenase light chain (E.C.1.4.99.3), Amicyanin Functional site 1) chain A residue 54 type sequence H description BINDING SITE FOR RESIDUE CU A 107 source : AC1 2) chain A residue 93 type sequence C description BINDING SITE FOR RESIDUE CU A 107 source : AC1 3) chain A residue 96 type sequence H description BINDING SITE FOR RESIDUE CU A 107 source : AC1 4) chain A residue 99 type sequence M description BINDING SITE FOR RESIDUE CU A 107 source : AC1 5) chain A residue 54 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 6) chain A residue 93 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI1 7) chain A residue 96 type BINDING sequence H description source Swiss-Prot : SWS_FT_FI1 8) chain A residue 99 type BINDING sequence M description source Swiss-Prot : SWS_FT_FI1 9) chain A residue 86-99 type prosite sequence AGSYDYFCTPHPFM description COPPER_BLUE Type-1 copper (blue) proteins signature. AgsYdYFCt.P.Hpf..M source prosite : PS00196 10) chain A residue 1 type MOD_RES sequence Q description Pyrrolidone carboxylic acid => ECO:0000269|PubMed:2002033 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links