eF-site ID 3c6w-C PDB Code 3c6w Chain C click to enlarge Title Crystal structure of the ING5 PHD finger in complex with H3K4me3 peptide Classification METAL BINDING PROTEIN Compound Inhibitor of growth protein 5 Source Homo sapiens (Human) (3C6W) Sequence C:  NEPTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKP KGKWFCPRCVQE Description (1)  Inhibitor of growth protein 5 Functional site 1) chain C residue 189 type sequence C description BINDING SITE FOR RESIDUE ZN C 3 source : AC3 2) chain C residue 191 type sequence C description BINDING SITE FOR RESIDUE ZN C 3 source : AC3 3) chain C residue 213 type sequence H description BINDING SITE FOR RESIDUE ZN C 3 source : AC3 4) chain C residue 216 type sequence C description BINDING SITE FOR RESIDUE ZN C 3 source : AC3 5) chain C residue 202 type sequence C description BINDING SITE FOR RESIDUE ZN C 4 source : AC4 6) chain C residue 207 type sequence C description BINDING SITE FOR RESIDUE ZN C 4 source : AC4 7) chain C residue 229 type sequence C description BINDING SITE FOR RESIDUE ZN C 4 source : AC4 8) chain C residue 232 type sequence C description BINDING SITE FOR RESIDUE ZN C 4 source : AC4 9) chain C residue 186-235 type ZN_FING sequence PTYCLCHQVSYGEMIGCDNPDCPIEWFHFACVDLTTKPKG KWFCPRCVQE description PHD-type => ECO:0000255|PROSITE-ProRule:PRU00146 source Swiss-Prot : SWS_FT_FI1 10) chain C residue 191 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 11) chain C residue 202 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 12) chain C residue 207 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 13) chain C residue 213 type BINDING sequence H description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 14) chain C residue 216 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 15) chain C residue 229 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 16) chain C residue 232 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 17) chain C residue 189 type BINDING sequence C description BINDING => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI2 18) chain C residue 188 type SITE sequence Y description Histone H3K4me3 binding => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI3 19) chain C residue 199 type SITE sequence M description Histone H3K4me3 binding => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI3 20) chain C residue 203 type SITE sequence D description Histone H3K4me3 binding => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI3 21) chain C residue 211 type SITE sequence W description Histone H3K4me3 binding => ECO:0000269|PubMed:18623064, ECO:0007744|PDB:3C6W source Swiss-Prot : SWS_FT_FI3

Display surface Download Links