eF-site ID 3bxs-A PDB Code 3bxs Chain A click to enlarge Title Crystal Structures Of Highly Constrained Substrate And Hydrolysis Products Bound To HIV-1 Protease. Implications For Catalytic Mechanism Classification HYDROLASE Compound Protease Source Human immunodeficiency virus type 1 group M subtype B (isolate ARV2/SF2) (HIV-1) (POL_HV1A2) Sequence A:  PQITLWKRPLVTIRIGGQLKEALLDTGADDTVIEEMNLPG KWKPKMIGGIGGFIKVRQYDQIPVEIXGHKAIGTVLVGPT PVNIIGRNLLTQIGXTLNF Description Functional site 1) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE SO4 B 601 source : AC1 2) chain A residue 70 type sequence K description BINDING SITE FOR RESIDUE SO4 B 601 source : AC1 3) chain A residue 1 type sequence P description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 4) chain A residue 57 type sequence R description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 5) chain A residue 69 type sequence H description BINDING SITE FOR RESIDUE SO4 A 602 source : AC2 6) chain A residue 14 type sequence R description BINDING SITE FOR RESIDUE SO4 A 603 source : AC3 7) chain A residue 17 type sequence G description BINDING SITE FOR RESIDUE SO4 A 603 source : AC3 8) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE DRS A 201 source : AC4 9) chain A residue 27 type sequence G description BINDING SITE FOR RESIDUE DRS A 201 source : AC4 10) chain A residue 28 type sequence A description BINDING SITE FOR RESIDUE DRS A 201 source : AC4 11) chain A residue 29 type sequence D description BINDING SITE FOR RESIDUE DRS A 201 source : AC4 12) chain A residue 48 type sequence G description BINDING SITE FOR RESIDUE DRS A 201 source : AC4 13) chain A residue 49 type sequence G description BINDING SITE FOR RESIDUE DRS A 201 source : AC4 14) chain A residue 8 type sequence R description BINDING SITE FOR RESIDUE DRS B 203 source : AC5 15) chain A residue 25 type sequence D description BINDING SITE FOR RESIDUE DRS B 203 source : AC5 16) chain A residue 81 type sequence P description BINDING SITE FOR RESIDUE DRS B 203 source : AC5 17) chain A residue 84 type sequence I description BINDING SITE FOR RESIDUE DRS B 203 source : AC5 18) chain A residue 22-33 type prosite sequence ALLDTGADDTVI description ASP_PROTEASE Eukaryotic and viral aspartyl proteases active site. ALLDTGADDTVI source prosite : PS00141 19) chain A residue 25 type ACT_SITE sequence D description For protease activity; shared with dimeric partner => ECO:0000255|PROSITE-ProRule:PRU10094 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 99 type SITE sequence F description Cleavage; by viral protease => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links