eF-site ID 3bsz-A PDB Code 3bsz Chain A click to enlarge Title Crystal structure of the transthyretin-retinol binding protein-Fab complex Classification TRANSPORT PROTEIN/IMMUNE SYSTEM Compound Transthyretin Source ORGANISM_COMMON: Human; ORGANISM_SCIENTIFIC: Homo sapiens; Sequence A:  ESKCPLMVKVLDAVRGSPAINVAVHVFRKAADDTWEPFAS GKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISP FHEHAEVVFTANDSGPRRYTIAALLSPYSYSTTAVVTNP Description Functional site 1) chain A residue 117 type BINDING sequence S description BINDING => ECO:0000250|UniProtKB:P27485 source Swiss-Prot : SWS_FT_FI1 2) chain A residue 98 type CARBOHYD sequence N description N-linked (GlcNAc...) asparagine => ECO:0000269|PubMed:16335952, ECO:0000269|PubMed:19167329 source Swiss-Prot : SWS_FT_FI5 3) chain A residue 42 type MOD_RES sequence E description 4-carboxyglutamate; in a patient with Moyamoya disease => ECO:0000269|PubMed:18221012 source Swiss-Prot : SWS_FT_FI3 4) chain A residue 52 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P02767 source Swiss-Prot : SWS_FT_FI4 5) chain A residue 15-30 type prosite sequence KVLDAVRGSPAINVAV description TRANSTHYRETIN_1 Transthyretin signature 1. KVLDavrGsPAinVaV source prosite : PS00768 6) chain A residue 105-117 type prosite sequence YTIAALLSPYSYS description TRANSTHYRETIN_2 Transthyretin signature 2. YTIAalLSPYSYS source prosite : PS00769

Display surface Download Links