eF-site ID 3bo9-A PDB Code 3bo9 Chain A click to enlarge Title Crystal structure of putative nitroalkan dioxygenase (TM0800) from Thermotoga maritima at 2.71 A resolution Classification OXIDOREDUCTASE Compound Putative nitroalkan dioxygenase Source (Q9WZQ7_THEMA) Sequence A:  HXTVRTRVTDLLEIEHPILXGGXAWAGTPTLAAAVSEAGG LGIIGSGAXKPDDLRKAISELRQKTDKPFGVNIILVSPWA DDLVKVCIEEKVPVVTFGAGNPTKYIRELKENGTKVIPVV ASDSLARXVERAGADAVIAEGXESGGHIGEVTTFVLVNKV SRSVNIPVIAAGGIADGRGXAAAFALGAEAVQXGTRFVAS VESDVHPVYKEKIVKASIRDTVVTGAKLGHPARVLRTPFA RKIQEXEFENPXQAEEXLVGSLRRAVVEGDLERGSFXVGQ SAGLIDEIKPVKQIIEDILKEFKETVEKLRGYIE Description Functional site 1) chain A residue 143 type sequence S description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 2) chain A residue 144 type sequence G description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 3) chain A residue 171 type sequence G description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 4) chain A residue 172 type sequence G description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 5) chain A residue 192 type sequence X description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 6) chain A residue 193 type sequence G description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 7) chain A residue 194 type sequence T description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 8) chain A residue 280 type sequence S description BINDING SITE FOR RESIDUE PO4 A 315 source : AC1 9) chain A residue 24 type sequence W description BINDING SITE FOR RESIDUE SO4 A 316 source : AC3 10) chain A residue 259 type sequence G description BINDING SITE FOR RESIDUE SO4 A 316 source : AC3 11) chain A residue 260 type sequence S description BINDING SITE FOR RESIDUE SO4 A 316 source : AC3 12) chain A residue 261 type sequence L description BINDING SITE FOR RESIDUE SO4 A 316 source : AC3 13) chain A residue 262 type sequence R description BINDING SITE FOR RESIDUE SO4 A 316 source : AC3 14) chain A residue 121 type sequence S description BINDING SITE FOR RESIDUE SO4 B 317 source : AC5 15) chain A residue 122 type sequence D description BINDING SITE FOR RESIDUE SO4 B 317 source : AC5 16) chain A residue 123 type sequence S description BINDING SITE FOR RESIDUE SO4 B 317 source : AC5 17) chain A residue 216 type sequence S description BINDING SITE FOR RESIDUE SO4 A 317 source : AC6 18) chain A residue 217 type sequence I description BINDING SITE FOR RESIDUE SO4 A 317 source : AC6 19) chain A residue 218 type sequence R description BINDING SITE FOR RESIDUE SO4 A 317 source : AC6 20) chain A residue 259 type sequence G description BINDING SITE FOR RESIDUE SO4 A 318 source : AC7 21) chain A residue 262 type sequence R description BINDING SITE FOR RESIDUE SO4 A 318 source : AC7 22) chain A residue 262 type sequence R description BINDING SITE FOR RESIDUE SO4 A 318 source : AC7 23) chain A residue 263 type sequence R description BINDING SITE FOR RESIDUE SO4 A 318 source : AC7 24) chain A residue 263 type sequence R description BINDING SITE FOR RESIDUE SO4 A 318 source : AC7 25) chain A residue 214 type sequence K description BINDING SITE FOR RESIDUE SO4 A 319 source : AC8 26) chain A residue 61 type sequence R description BINDING SITE FOR RESIDUE EDO A 320 source : AC9 27) chain A residue 64 type sequence T description BINDING SITE FOR RESIDUE EDO A 320 source : AC9 28) chain A residue 65 type sequence D description BINDING SITE FOR RESIDUE EDO A 320 source : AC9 29) chain A residue 66 type sequence K description BINDING SITE FOR RESIDUE EDO A 320 source : AC9 30) chain A residue 211 type sequence K description BINDING SITE FOR RESIDUE 2PE A 321 source : BC1 31) chain A residue 214 type sequence K description BINDING SITE FOR RESIDUE 2PE A 321 source : BC1 32) chain A residue 219 type sequence D description BINDING SITE FOR RESIDUE 2PE A 321 source : BC1 33) chain A residue 235 type sequence R description BINDING SITE FOR RESIDUE 2PE A 321 source : BC1 34) chain A residue 270 type sequence L description BINDING SITE FOR RESIDUE 2PE A 321 source : BC1 35) chain A residue 59 type sequence E description BINDING SITE FOR RESIDUE 2PE A 322 source : BC3 36) chain A residue 62 type sequence Q description BINDING SITE FOR RESIDUE 2PE A 322 source : BC3 37) chain A residue 63 type sequence K description BINDING SITE FOR RESIDUE 2PE A 322 source : BC3 38) chain A residue 303 type sequence E description BINDING SITE FOR RESIDUE 2PE A 323 source : BC4 39) chain A residue 304 type sequence T description BINDING SITE FOR RESIDUE 2PE A 323 source : BC4 40) chain A residue 307 type sequence K description BINDING SITE FOR RESIDUE 2PE A 323 source : BC4 41) chain A residue 183 type sequence F description BINDING SITE FOR RESIDUE 2PE B 319 source : BC5 42) chain A residue 184 type sequence A description BINDING SITE FOR RESIDUE 2PE B 319 source : BC5 43) chain A residue 187 type sequence A description BINDING SITE FOR RESIDUE 2PE B 319 source : BC5 44) chain A residue 160 type sequence S description BINDING SITE FOR RESIDUE 2PE B 321 source : BC7 45) chain A residue 226 type sequence K description BINDING SITE FOR RESIDUE 2PE A 324 source : BC9

Display surface Download Links