eF-site ID 3bjz-A PDB Code 3bjz Chain A click to enlarge Title Crystal structure of Pseudomonas aeruginosa phosphoheptose isomerase Classification ISOMERASE Compound Phosphoheptose isomerase Source Pseudomonas aeruginosa (GMHA_PSEAE) Sequence A:  DXQHRIRQLFQASIETKQQALEVLPPYIEQASLVXVNALL NEGKILSCGNGGSAGDAQHFSSELLNRFERERPSLPAVAL TYNEVFSKQIRALGQPGDVLLAISTSGNSANVIQAIQAAH DREXLVVALTGRDGGGXASLLLPEDVEIRVPSKITARIQE VHLLAIHCLCDLIDRQLFG Description (1)  Phosphoheptose isomerase (E.C.5.3.1.-) Functional site 1) chain A residue 51 type sequence N description BINDING SITE FOR RESIDUE SO4 A 198 source : AC1 2) chain A residue 54 type sequence S description BINDING SITE FOR RESIDUE SO4 A 198 source : AC1 3) chain A residue 119 type sequence S description BINDING SITE FOR RESIDUE SO4 A 198 source : AC1 4) chain A residue 120 type sequence T description BINDING SITE FOR RESIDUE SO4 A 198 source : AC1 5) chain A residue 121 type sequence S description BINDING SITE FOR RESIDUE SO4 A 198 source : AC1 6) chain A residue 124 type sequence S description BINDING SITE FOR RESIDUE SO4 A 198 source : AC1 7) chain A residue 51 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI1 8) chain A residue 119 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI1 9) chain A residue 124 type BINDING sequence S description source Swiss-Prot : SWS_FT_FI1 10) chain A residue 60 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 11) chain A residue 64 type BINDING sequence E description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 12) chain A residue 174 type BINDING sequence Q description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2 13) chain A residue 182 type BINDING sequence H description BINDING => ECO:0000250 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links