eF-site ID 3bjh-A PDB Code 3bjh Chain A click to enlarge Title Soft-SAD crystal structure of a pheromone binding protein from the honeybee Apis mellifera L. Classification PHEROMONE BINDING PROTEIN Compound Pheromone-binding protein ASP1 Source Apis mellifera (Honeybee) (Q9U9J6_APIME) Sequence A:  DWVPPEVFDLVAEDKARCMSEHGTTQAQIDDVDKGNLVNE PSITCYMYCLLEAFSLVDDEANVDEDIMLGLLPDQLQERA QSVMGKCLPTSGSDNCNKIYNLAKCVQESAPDVWFVI Description (1)  Pheromone-binding protein ASP1 Functional site 1) chain A residue 49 type sequence M description BINDING SITE FOR RESIDUE NBB A 120 source : AC1 2) chain A residue 52 type sequence L description BINDING SITE FOR RESIDUE NBB A 120 source : AC1 3) chain A residue 53 type sequence L description BINDING SITE FOR RESIDUE NBB A 120 source : AC1 4) chain A residue 58 type sequence L description BINDING SITE FOR RESIDUE NBB A 120 source : AC1 5) chain A residue 117 type sequence F description BINDING SITE FOR RESIDUE NBB A 120 source : AC1 6) chain A residue 119 type sequence I description BINDING SITE FOR RESIDUE NBB A 120 source : AC1

Display surface Download Links