eF-site ID 3be9-A PDB Code 3be9 Chain A click to enlarge Title Structure-based design and synthesis of novel macrocyclic pyrazolo[1,5-a] [1,3,5]triazine compounds as potent inhibitors of protein kinase CK2 and their anticancer activities Classification TRANSFERASE Compound Casein kinase II subunit alpha Source Zea mays (Maize) (CSK2A_MAIZE) Sequence A:  MSKARVYADVNVLRPKEYWDYEALTVQWGEQDDYEVVRKV GRGKYSEVFEGINVNNNEKCIIKILKPVKKKKIKREIKIL QNLXGGPNIVKLLDIVRDQHSKTPSLIFEYVNNTDFKVLY PTLTDYDIRYYIYELLKALDYCHSQGIMHRDVKPHNVMID HELRKLRLIDWGLAEFYHPGKEYNVRVASRYFKGPELLVD LQDYDYSLDMWSLGCMFAGMIFRKEPFFYGHDNHDQLVKI AKVLGTDGLNAYLNKYRIELDPQLEALVGRHSRKPWLKFM NADNQHLVSPEAIDFLDKLLRYDHQERLTALEAMTHPYFQ QVRAAENS Description Functional site 1) chain A residue 47 type sequence R description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 2) chain A residue 66 type sequence I description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 3) chain A residue 68 type sequence K description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 4) chain A residue 113 type sequence F description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 5) chain A residue 114 type sequence E description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 6) chain A residue 115 type sequence Y description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 7) chain A residue 163 type sequence M description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 8) chain A residue 174 type sequence I description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 9) chain A residue 175 type sequence D description BINDING SITE FOR RESIDUE P04 A 501 source : AC1 10) chain A residue 156 type ACT_SITE sequence D description Proton acceptor source Swiss-Prot : SWS_FT_FI1 11) chain A residue 45 type BINDING sequence V description source Swiss-Prot : SWS_FT_FI2 12) chain A residue 68 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 13) chain A residue 45-68 type prosite sequence VGRGKYSEVFEGINVNNNEKCIIK description PROTEIN_KINASE_ATP Protein kinases ATP-binding region signature. VGRGKYSEVFeGinvnnnek..........CIIK source prosite : PS00107 14) chain A residue 152-164 type prosite sequence IMHRDVKPHNVMI description PROTEIN_KINASE_ST Serine/Threonine protein kinases active-site signature. ImHrDVKphNVMI source prosite : PS00108

Display surface Download Links