eF-site ID 3bdx-C PDB Code 3bdx Chain C click to enlarge Title Crystal structure of the unstable and highly fibrillogenic Pro7Ser mutant of the Recombinant variable domain 6AJL2 Classification IMMUNE SYSTEM Compound Amyloid lambda 6 light chain variable region PIP (fragment) Source Homo sapiens (Human) (Q96JD1_HUMAN) Sequence C:  NFMLTQSHSVSESPGKTVTISCTRSSGSIASNYVQWYQQR PGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISG LKTEDEADYYCQSYDSSNHVVFGGGTKLTVL Description Functional site 1) chain C residue 55 type sequence R description BINDING SITE FOR RESIDUE ACT A 404 source : AC4 2) chain C residue 57 type sequence S description BINDING SITE FOR RESIDUE ACT A 404 source : AC4 3) chain C residue 66 type sequence S description BINDING SITE FOR RESIDUE ACT C 405 source : AC5 4) chain C residue 68 type sequence D description BINDING SITE FOR RESIDUE ACT C 405 source : AC5 5) chain C residue 75 type sequence S description BINDING SITE FOR RESIDUE ACT C 405 source : AC5 6) chain C residue 38 type sequence Q description BINDING SITE FOR RESIDUE GOL C 502 source : AC8 7) chain C residue 60 type sequence P description BINDING SITE FOR RESIDUE GOL C 502 source : AC8 8) chain C residue 62 type sequence R description BINDING SITE FOR RESIDUE GOL C 502 source : AC8 9) chain C residue 84 type sequence E description BINDING SITE FOR RESIDUE GOL C 502 source : AC8 10) chain C residue 85 type sequence D description BINDING SITE FOR RESIDUE GOL C 502 source : AC8 11) chain C residue 69 type sequence S description BINDING SITE FOR RESIDUE GOL B 504 source : BC1

Display surface Download Links