eF-site ID 3bdx-B PDB Code 3bdx Chain B click to enlarge Title Crystal structure of the unstable and highly fibrillogenic Pro7Ser mutant of the Recombinant variable domain 6AJL2 Classification IMMUNE SYSTEM Compound Amyloid lambda 6 light chain variable region PIP (fragment) Source Homo sapiens (Human) (Q96JD1_HUMAN) Sequence B:  NFMLTQSHSVSESPGKTVTISCTRSSGSIASNYVQWYQQR PGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISG LKTEDEADYYCQSYDSSNHVVFGGGTKLTVL Description Functional site 1) chain B residue 45 type sequence P description BINDING SITE FOR RESIDUE ACT A 401 source : AC1 2) chain B residue 47 type sequence T description BINDING SITE FOR RESIDUE ACT A 401 source : AC1 3) chain B residue 102 type sequence F description BINDING SITE FOR RESIDUE ACT A 402 source : AC2 4) chain B residue 33 type sequence Y description BINDING SITE FOR RESIDUE ACT B 403 source : AC3 5) chain B residue 35 type sequence Q description BINDING SITE FOR RESIDUE ACT B 403 source : AC3 6) chain B residue 94 type sequence Y description BINDING SITE FOR RESIDUE ACT B 403 source : AC3 7) chain B residue 50 type sequence Y description BINDING SITE FOR RESIDUE ACT A 404 source : AC4 8) chain B residue 32 type sequence N description BINDING SITE FOR RESIDUE MES B 601 source : AC6 9) chain B residue 33 type sequence Y description BINDING SITE FOR RESIDUE MES B 601 source : AC6 10) chain B residue 94 type sequence Y description BINDING SITE FOR RESIDUE MES B 601 source : AC6 11) chain B residue 98 type sequence N description BINDING SITE FOR RESIDUE MES B 601 source : AC6 12) chain B residue 42 type sequence G description BINDING SITE FOR RESIDUE GOL A 503 source : AC9 13) chain B residue 30 type sequence A description BINDING SITE FOR RESIDUE GOL B 504 source : BC1

Display surface Download Links