eF-site ID 3bdx-A PDB Code 3bdx Chain A click to enlarge Title Crystal structure of the unstable and highly fibrillogenic Pro7Ser mutant of the Recombinant variable domain 6AJL2 Classification IMMUNE SYSTEM Compound Amyloid lambda 6 light chain variable region PIP (fragment) Source Homo sapiens (Human) (Q96JD1_HUMAN) Sequence A:  NFMLTQSHSVSESPGKTVTISCTRSSGSIASNYVQWYQQR PGSSPTTVIYEDNQRPSGVPDRFSGSIDSSSNSASLTISG LKTEDEADYYCQSYDSSNHVVFGGGTKLTVL Description Functional site 1) chain A residue 101 type sequence V description BINDING SITE FOR RESIDUE ACT A 401 source : AC1 2) chain A residue 102 type sequence F description BINDING SITE FOR RESIDUE ACT A 401 source : AC1 3) chain A residue 45 type sequence P description BINDING SITE FOR RESIDUE ACT A 402 source : AC2 4) chain A residue 46 type sequence T description BINDING SITE FOR RESIDUE ACT A 402 source : AC2 5) chain A residue 47 type sequence T description BINDING SITE FOR RESIDUE ACT A 402 source : AC2 6) chain A residue 98 type sequence N description BINDING SITE FOR RESIDUE ACT B 403 source : AC3 7) chain A residue 99 type sequence H description BINDING SITE FOR RESIDUE ACT A 404 source : AC4 8) chain A residue 98 type sequence N description BINDING SITE FOR RESIDUE MES B 601 source : AC6 9) chain A residue 30 type sequence A description BINDING SITE FOR RESIDUE GOL A 501 source : AC7 10) chain A residue 31 type sequence S description BINDING SITE FOR RESIDUE GOL A 501 source : AC7 11) chain A residue 9 type sequence S description BINDING SITE FOR RESIDUE GOL A 503 source : AC9 12) chain A residue 90 type sequence Y description BINDING SITE FOR RESIDUE GOL A 503 source : AC9 13) chain A residue 104 type sequence G description BINDING SITE FOR RESIDUE GOL A 503 source : AC9 14) chain A residue 105 type sequence G description BINDING SITE FOR RESIDUE GOL A 503 source : AC9 15) chain A residue 107 type sequence K description BINDING SITE FOR RESIDUE GOL A 503 source : AC9

Display surface Download Links