eF-site ID 3bbb-E PDB Code 3bbb Chain E click to enlarge Title Crystal structure of the NM23-H2 transcription factor complex with dinucleotide d(AG) Classification TRANSFERASE Compound Nucleoside diphosphate kinase B Source Homo sapiens (Human) (NDKB_HUMAN) Sequence E:  ERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRAS EEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVV KTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVK SAEKEISLWFKPEELVDYKSCAHDWVYE Description Functional site 1) chain E residue 12 type sequence K description BINDING SITE FOR RESIDUE DA E 153 source : AC3 2) chain E residue 52 type sequence Y description BINDING SITE FOR RESIDUE DA E 153 source : AC3 3) chain E residue 64 type sequence L description BINDING SITE FOR RESIDUE DA E 153 source : AC3 4) chain E residue 112 type sequence V description BINDING SITE FOR RESIDUE DA E 153 source : AC3 5) chain E residue 60 type sequence F description BINDING SITE FOR RESIDUE DG E 154 source : AC4 6) chain E residue 94 type sequence T description BINDING SITE FOR RESIDUE DG E 154 source : AC4 7) chain E residue 115 type sequence N description BINDING SITE FOR RESIDUE DG E 154 source : AC4 8) chain E residue 122 type sequence S description BINDING SITE FOR RESIDUE DG B 153 source : AC5 9) chain E residue 123 type sequence V description BINDING SITE FOR RESIDUE DG B 153 source : AC5 10) chain E residue 152 type sequence E description BINDING SITE FOR RESIDUE DG F 153 source : AC6 11) chain E residue 118 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000269|PubMed:1851158 source Swiss-Prot : SWS_FT_FI1 12) chain E residue 12 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 13) chain E residue 60 type BINDING sequence F description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 14) chain E residue 88 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 15) chain E residue 94 type BINDING sequence T description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 16) chain E residue 105 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 17) chain E residue 115 type BINDING sequence N description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2

Display surface Download Links