eF-site ID 3bbb-A PDB Code 3bbb Chain A click to enlarge Title Crystal structure of the NM23-H2 transcription factor complex with dinucleotide d(AG) Classification TRANSFERASE Compound Nucleoside diphosphate kinase B Source null (NDKB_HUMAN) Sequence A:  ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFL RASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGL NVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSD SVKSAEKEISLWFKPEELVDYKSCAHDWVYE Description Functional site 1) chain A residue 115-123 type prosite sequence NIIHGSDSV description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NiiHGSDSV source prosite : PS00469 2) chain A residue 118 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000269|PubMed:1851158 source Swiss-Prot : SWS_FT_FI1 3) chain A residue 12 type BINDING sequence K description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 4) chain A residue 60 type BINDING sequence F description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 5) chain A residue 88 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 6) chain A residue 94 type BINDING sequence T description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 7) chain A residue 105 type BINDING sequence R description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2 8) chain A residue 115 type BINDING sequence N description BINDING => ECO:0000269|PubMed:19435876, ECO:0007744|PDB:3BBF source Swiss-Prot : SWS_FT_FI2

Display surface Download Links