eF-site ID 3b8t-A PDB Code 3b8t Chain A click to enlarge Title Crystal structure of Escherichia coli alaine racemase mutant P219A Classification ISOMERASE Compound Alanine racemase Source null (ALR1_ECOLI) Sequence A:  MQAATVVINRRALRHNLQRLRELAPASKMVAVVKANAYGH GLLETARTLPDADAFGVARLEEALRLRAGGITKPVLLLEG FFDARDLPTISAQHFHTAVHNEEQLAALEEASLDEPVTVW MXLDTGMHRLGVRPEQAEAFYHRLTQCKNVRQPVNIVSHF ARADEPKCGATEKQLAIFNTFCEGKPGQRSIAASGGILLW PQSHFDWVRPGIILYGVSALEDRSTGADFGCQPVMSLTSS LIAVREHKAGEPVGYGGTWVSERDTRLGVVAMGYGDGYPR AAPSGTPVLVNGREVPIVGRVAMDMICVDLGPQAQDKAGD PVILWGEGLPVERIAEMTKVSAYELITRLTSRVAMKYVD Description Functional site 1) chain A residue 19 type sequence R description BINDING SITE FOR RESIDUE SO4 A 360 source : AC1 2) chain A residue 162 type sequence R description BINDING SITE FOR RESIDUE SO4 A 361 source : AC2 3) chain A residue 266 type sequence R description BINDING SITE FOR RESIDUE SO4 B 360 source : AC3 4) chain A residue 255 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 362 source : AC7 5) chain A residue 274 type sequence Y description BINDING SITE FOR RESIDUE SO4 A 362 source : AC7 6) chain A residue 280 type sequence R description BINDING SITE FOR RESIDUE SO4 A 362 source : AC7 7) chain A residue 34 type sequence K description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 8) chain A residue 38 type sequence Y description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 9) chain A residue 159 type sequence H description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 10) chain A residue 193 type sequence A description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 11) chain A residue 194 type sequence S description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 12) chain A residue 209 type sequence R description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 13) chain A residue 211 type sequence G description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 14) chain A residue 212 type sequence I description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 15) chain A residue 343 type sequence Y description BINDING SITE FOR RESIDUE PLP A 1001 source : AC8 16) chain A residue 31-41 type prosite sequence AVVKANAYGHG description ALANINE_RACEMASE Alanine racemase pyridoxal-phosphate attachment site. AVvKANAYGHG source prosite : PS00395 17) chain A residue 34 type ACT_SITE sequence K description Proton acceptor; specific for D-alanine => ECO:0000255|HAMAP-Rule:MF_01201 source Swiss-Prot : SWS_FT_FI1 18) chain A residue 255 type ACT_SITE sequence Y description Proton acceptor; specific for L-alanine => ECO:0000255|HAMAP-Rule:MF_01201 source Swiss-Prot : SWS_FT_FI2 19) chain A residue 129 type BINDING sequence R description BINDING => ECO:0000305|PubMed:18434499 source Swiss-Prot : SWS_FT_FI3 20) chain A residue 303 type BINDING sequence M description BINDING => ECO:0000305|PubMed:18434499 source Swiss-Prot : SWS_FT_FI3 21) chain A residue 34 type MOD_RES sequence K description N6-(pyridoxal phosphate)lysine => ECO:0000269|PubMed:18434499 source Swiss-Prot : SWS_FT_FI4 22) chain A residue 122 type MOD_RES sequence X description N6-carboxylysine => ECO:0000269|PubMed:18434499 source Swiss-Prot : SWS_FT_FI5

Display surface Download Links