eF-site ID 3b7g-A PDB Code 3b7g Chain A click to enlarge Title Human DEAD-box RNA helicase DDX20, Conserved domain I (DEAD) in complex with AMPPNP (Adenosine-(Beta,gamma)-imidotriphosphate) Classification HYDROLASE Compound Probable ATP-dependent RNA helicase DDX20 Source Homo sapiens (Human) (DDX20_HUMAN) Sequence A:  ADFESLLLSRPVLEGLRAAGFERPSPVQLKAIPLGRCGLD LIVQAKSGTGKTCVFSTIALDSLVLENLSTQILILAPTRE IAVQIHSVITAIGIKMEGLECHVFIGGTPLSQDKTRLKKC HIAVGSPGRIKQLIELDYLNPGSIRLFILDEADKLLEEGS FQEQINWIYSSLPASKQMLAVSATYPEFLANALTKYMRDP TFVRL Description Functional site 1) chain A residue 81 type sequence G description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 2) chain A residue 82 type sequence F description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 3) chain A residue 84 type sequence R description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 4) chain A residue 89 type sequence Q description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 5) chain A residue 108 type sequence S description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 6) chain A residue 109 type sequence G description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 7) chain A residue 110 type sequence T description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 8) chain A residue 111 type sequence G description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 9) chain A residue 112 type sequence K description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 10) chain A residue 113 type sequence T description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 11) chain A residue 114 type sequence C description BINDING SITE FOR RESIDUE ANP A 300 source : AC1 12) chain A residue 209-217 type prosite sequence ILDEADKLL description DEAD_ATP_HELICASE DEAD-box subfamily ATP-dependent helicases signature. ILDEADKlL source prosite : PS00039 13) chain A residue 84 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI1 14) chain A residue 89 type BINDING sequence Q description source Swiss-Prot : SWS_FT_FI1 15) chain A residue 109 type BINDING sequence G description source Swiss-Prot : SWS_FT_FI1 16) chain A residue 187 type MOD_RES sequence S description Phosphoserine => ECO:0007744|PubMed:18691976 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links