eF-site ID 3b6b-D PDB Code 3b6b Chain D click to enlarge Title Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dGDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence D:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPE Description Functional site 1) chain D residue 86 type sequence R description BINDING SITE FOR RESIDUE MG D 138 source : AC3 2) chain D residue 99 type sequence R description BINDING SITE FOR RESIDUE MG D 138 source : AC3 3) chain D residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 4) chain D residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 5) chain D residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 6) chain D residue 62 type sequence N description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 7) chain D residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 8) chain D residue 99 type sequence R description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 9) chain D residue 106 type sequence I description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 10) chain D residue 107 type sequence R description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 11) chain D residue 109 type sequence N description BINDING SITE FOR RESIDUE DGI D 142 source : AC7 12) chain D residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 13) chain D residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 14) chain D residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 15) chain D residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 16) chain D residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 17) chain D residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2

Display surface Download Links