eF-site ID 3b6b-ACE PDB Code 3b6b Chain A, C, E click to enlarge Title Crystal structure of Acanthamoeba polyphaga mimivirus nucleoside diphosphate kinase complexed with dGDP Classification TRANSFERASE Compound Nucleoside diphosphate kinase Source Acanthamoeba polyphaga mimivirus (APMV) (NDK_MIMIV) Sequence A:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPE C:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPET E:  GLQRTLVLIKPDAFERSLVAEIMGRIEKKNFKIVSMKFWS KAPRNLIEQHYKEHSEQSYFNDNCDFMVSGPIISIVYEGT DAISKIRRLQGNILTPGTIRGDLANDIRENLIHASDSEDS AVDEISIWFPE Description Functional site 1) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE MG A 138 source : AC1 2) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE MG A 138 source : AC1 3) chain A residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 4) chain A residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 5) chain A residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 6) chain A residue 62 type sequence N description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 7) chain A residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 8) chain A residue 99 type sequence R description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 9) chain A residue 106 type sequence I description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 10) chain A residue 107 type sequence R description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 11) chain A residue 109 type sequence N description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 12) chain A residue 115 type sequence D description BINDING SITE FOR RESIDUE DGI A 139 source : AC4 13) chain C residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 14) chain C residue 50 type sequence Y description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 15) chain C residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 16) chain C residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 17) chain C residue 62 type sequence N description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 18) chain C residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 19) chain C residue 99 type sequence R description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 20) chain C residue 106 type sequence I description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 21) chain C residue 107 type sequence R description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 22) chain C residue 109 type sequence N description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 23) chain C residue 112 type sequence H description BINDING SITE FOR RESIDUE DGI C 141 source : AC6 24) chain E residue 9 type sequence K description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 25) chain E residue 53 type sequence H description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 26) chain E residue 58 type sequence Y description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 27) chain E residue 62 type sequence N description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 28) chain E residue 86 type sequence R description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 29) chain E residue 99 type sequence R description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 30) chain E residue 106 type sequence I description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 31) chain E residue 107 type sequence R description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 32) chain E residue 109 type sequence N description BINDING SITE FOR RESIDUE DGI E 143 source : AC8 33) chain A residue 109-117 type prosite sequence NLIHASDSE description NDPK Nucleoside diphosphate kinase (NDPK) active site signature. NliHASDSE source prosite : PS00469 34) chain A residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 35) chain C residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 36) chain C residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 37) chain C residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 38) chain C residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 39) chain C residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 40) chain A residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 41) chain E residue 9 type BINDING sequence K description source Swiss-Prot : SWS_FT_FI2 42) chain E residue 58 type BINDING sequence Y description source Swiss-Prot : SWS_FT_FI2 43) chain E residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 44) chain E residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 45) chain E residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 46) chain A residue 86 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 47) chain A residue 99 type BINDING sequence R description source Swiss-Prot : SWS_FT_FI2 48) chain A residue 109 type BINDING sequence N description source Swiss-Prot : SWS_FT_FI2 49) chain A residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 50) chain C residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1 51) chain E residue 112 type ACT_SITE sequence H description Pros-phosphohistidine intermediate => ECO:0000255|PROSITE-ProRule:PRU10030 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links