eF-site ID 3b0f-B PDB Code 3b0f Chain B click to enlarge Title Crystal structure of the UBA domain of p62 and its interaction with ubiquitin Classification PROTEIN BINDING Compound Sequestosome-1 Source (SQSTM_MOUSE) Sequence B:  DPRLIESLSQMLSMGFSDEGGWLTRLLQTKNYDIGAALDT IQY Description Functional site 1) chain B residue 27 type sequence G description BINDING SITE FOR RESIDUE SO4 A 54 source : AC1 2) chain B residue 32 type sequence R description BINDING SITE FOR RESIDUE SO4 A 54 source : AC1 3) chain B residue 20 type MOD_RES sequence S description Phosphoserine; by ULK1 and TBK1 => ECO:0000269|PubMed:25723488 source Swiss-Prot : SWS_FT_FI1 4) chain B residue 24 type MOD_RES sequence S description Phosphoserine; by ULK1 => ECO:0000269|PubMed:25723488 source Swiss-Prot : SWS_FT_FI2 5) chain B residue 37 type MOD_RES sequence K description N6-acetyllysine; alternate => ECO:0000250|UniProtKB:Q13501 source Swiss-Prot : SWS_FT_FI3 6) chain B residue 37 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin); alternate => ECO:0000250|UniProtKB:Q13501 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links