eF-site ID 3azh-E PDB Code 3azh Chain E click to enlarge Title Crystal Structure of Human Nucleosome Core Particle Containing H3K122Q mutation Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.1 Source null (3AZH) Sequence E:  KPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQ DFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKR VTIMPQDIQLARRIRGERA Description Functional site 1) chain E residue 76 type sequence Q description BINDING SITE FOR RESIDUE MN D 201 source : AC2 2) chain E residue 77 type sequence D description BINDING SITE FOR RESIDUE MN D 201 source : AC2 3) chain E residue 121 type sequence P description BINDING SITE FOR RESIDUE CL E 1001 source : AC3 4) chain E residue 122 type sequence Q description BINDING SITE FOR RESIDUE CL E 1001 source : AC3 5) chain E residue 79 type MOD_RES sequence K description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:29211711 source Swiss-Prot : SWS_FT_FI21 6) chain E residue 80 type MOD_RES sequence T description Phosphothreonine => ECO:0000269|PubMed:20850016 source Swiss-Prot : SWS_FT_FI22 7) chain E residue 86 type MOD_RES sequence S description Phosphoserine => ECO:0000250|UniProtKB:P84243 source Swiss-Prot : SWS_FT_FI23 8) chain E residue 107 type MOD_RES sequence T description Phosphothreonine => ECO:0000250|UniProtKB:Q71DI3 source Swiss-Prot : SWS_FT_FI24 9) chain E residue 115 type MOD_RES sequence K description N6-glutaryllysine; alternate => ECO:0000269|PubMed:31542297 source Swiss-Prot : SWS_FT_FI25 10) chain E residue 122 type MOD_RES sequence Q description N6-succinyllysine; alternate => ECO:0000269|PubMed:22389435, ECO:0000269|PubMed:27436229 source Swiss-Prot : SWS_FT_FI26 11) chain E residue 56 type MOD_RES sequence K description Phosphoserine; by AMPK => ECO:0000250|UniProtKB:Q64475 source Swiss-Prot : SWS_FT_FI10

Display surface Download Links