eF-site ID 3azh-G PDB Code 3azh Chain G click to enlarge Title Crystal Structure of Human Nucleosome Core Particle Containing H3K122Q mutation Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.1 Source Homo sapiens (Human) (3AZH) Sequence G:  KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAV LEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELN KLLGRVTIAQGGVLPNIQAVLLPK Description Functional site 1) chain G residue 44 type sequence G description BINDING SITE FOR RESIDUE CL G 1001 source : AC4 2) chain G residue 45 type sequence A description BINDING SITE FOR RESIDUE CL G 1001 source : AC4 3) chain G residue 46 type sequence G description BINDING SITE FOR RESIDUE CL G 1001 source : AC4 4) chain G residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 5) chain G residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 6) chain G residue 118 type MOD_RES sequence K description PolyADP-ribosyl glutamic acid => ECO:0000250|UniProtKB:Q64475 source Swiss-Prot : SWS_FT_FI9 7) chain G residue 95 type MOD_RES sequence K description ADP-ribosylserine => ECO:0000269|PubMed:34874266 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links