eF-site ID 3azg-G PDB Code 3azg Chain G click to enlarge Title Crystal Structure of Human Nucleosome Core Particle Containing H3K115Q mutation Classification STRUCTURAL PROTEIN/DNA Compound Histone H3.1 Source Homo sapiens (Human) (3AZG) Sequence G:  KTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAV LEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELN KLLGRVTIAQGGVLPNIQAVLLPK Description Functional site 1) chain G residue 44 type sequence G description BINDING SITE FOR RESIDUE CL G 1001 source : AC5 2) chain G residue 46 type sequence G description BINDING SITE FOR RESIDUE CL G 1001 source : AC5 3) chain G residue 47 type sequence A description BINDING SITE FOR RESIDUE CL G 1001 source : AC5 4) chain G residue 95 type MOD_RES sequence K description ADP-ribosylserine => ECO:0000269|PubMed:34874266 source Swiss-Prot : SWS_FT_FI4 5) chain G residue 74 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 6) chain G residue 75 type MOD_RES sequence K description N6-(2-hydroxyisobutyryl)lysine => ECO:0000269|PubMed:24681537 source Swiss-Prot : SWS_FT_FI7 7) chain G residue 118 type MOD_RES sequence K description PolyADP-ribosyl glutamic acid => ECO:0000250|UniProtKB:Q64475 source Swiss-Prot : SWS_FT_FI9

Display surface Download Links