eF-site ID 3axc-A PDB Code 3axc Chain A click to enlarge Title Crystal structure of linear diubiquitin Classification SIGNALING PROTEIN Compound Ubiquitin Source Homo sapiens (Human) (RS27A_HUMAN) Sequence A:  MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQ QRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIF VKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI FAGKQLEDGRTLSDYNIQKESTLHLVLRL Description Functional site 1) chain A residue 16 type sequence E description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 2) chain A residue 17 type sequence V description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 3) chain A residue 21 type sequence D description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 4) chain A residue 25 type sequence N description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 5) chain A residue 29 type sequence K description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 6) chain A residue 94 type sequence E description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 7) chain A residue 97 type sequence D description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 8) chain A residue 105 type sequence K description BINDING SITE FOR RESIDUE GOL A 153 source : AC1 9) chain A residue 141 type MOD_RES sequence S description Phosphoserine; by PINK1 => ECO:0000269|PubMed:24660806, ECO:0000269|PubMed:24751536, ECO:0000269|PubMed:24784582, ECO:0000269|PubMed:25527291 source Swiss-Prot : SWS_FT_FI3 10) chain A residue 130 type SITE sequence R description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI1 11) chain A residue 148 type SITE sequence R description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI1 12) chain A residue 144 type SITE sequence H description Essential for function source Swiss-Prot : SWS_FT_FI2 13) chain A residue 142 type MOD_RES sequence T description (Microbial infection) ADP-ribosylthreonine => ECO:0000269|PubMed:32330457 source Swiss-Prot : SWS_FT_FI4 14) chain A residue 139 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144, ECO:0000269|PubMed:18719106 source Swiss-Prot : SWS_FT_FI12 15) chain A residue 105 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16543144, ECO:0000269|PubMed:25752573, ECO:0000269|PubMed:25752577, ECO:0000269|PubMed:34239127 source Swiss-Prot : SWS_FT_FI10 16) chain A residue 82 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16443603 source Swiss-Prot : SWS_FT_FI6 17) chain A residue 87 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16443603, ECO:0000269|PubMed:16543144 source Swiss-Prot : SWS_FT_FI8 18) chain A residue 124 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:16443603, ECO:0000269|PubMed:16543144 source Swiss-Prot : SWS_FT_FI8 19) chain A residue 109 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000269|PubMed:25752577 source Swiss-Prot : SWS_FT_FI11 20) chain A residue 103 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000305|PubMed:15466860 source Swiss-Prot : SWS_FT_FI9 21) chain A residue 27-52 type prosite sequence KAKIQDKEGIPPDQQRLIFAGKQLED description UBIQUITIN_1 Ubiquitin domain signature. KakIqDkegIPpdqQrLIFaGkqleD source prosite : PS00299 22) chain A residue 103-128 type prosite sequence KAKIQDKEGIPPDQQRLIFAGKQLED description UBIQUITIN_1 Ubiquitin domain signature. KakIqDkegIPpdqQrLIFaGkqleD source prosite : PS00299

Display surface Download Links