eF-site ID 3avr-A PDB Code 3avr Chain A click to enlarge Title Catalytic fragment of UTX/KDM6A bound with histone H3K27me3 peptide, N-oxyalylglycine, and Ni(II) Classification OXIDOREDUCTASE/STRUCTURAL PROTEIN Compound Lysine-specific demethylase 6A Source null (3AVR) Sequence A:  SVSIYPSSAEVLKACRNNSSILLDKCPPPRPPSSPYPPLP KDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRG LAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENW DPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLPFKTI KFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHV GHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPG DCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYE ANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVG PLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIK VSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGR TKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCA RKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPP Description Functional site 1) chain A residue 1137 type sequence K description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 2) chain A residue 1143 type sequence T description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 3) chain A residue 1146 type sequence H description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 4) chain A residue 1148 type sequence E description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 5) chain A residue 1154 type sequence S description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 6) chain A residue 1156 type sequence N description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 7) chain A residue 1166 type sequence W description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 8) chain A residue 1226 type sequence H description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 9) chain A residue 1238 type sequence A description BINDING SITE FOR RESIDUE OGA A 1501 source : AC1 10) chain A residue 1331 type sequence C description BINDING SITE FOR RESIDUE ZN A 1502 source : AC2 11) chain A residue 1334 type sequence C description BINDING SITE FOR RESIDUE ZN A 1502 source : AC2 12) chain A residue 1358 type sequence C description BINDING SITE FOR RESIDUE ZN A 1502 source : AC2 13) chain A residue 1361 type sequence C description BINDING SITE FOR RESIDUE ZN A 1502 source : AC2 14) chain A residue 1146 type sequence H description BINDING SITE FOR RESIDUE NI A 1503 source : AC3 15) chain A residue 1148 type sequence E description BINDING SITE FOR RESIDUE NI A 1503 source : AC3 16) chain A residue 1226 type sequence H description BINDING SITE FOR RESIDUE NI A 1503 source : AC3 17) chain A residue 1120 type sequence S description BINDING SITE FOR RESIDUE EDO A 1 source : AC4 18) chain A residue 946 type sequence E description BINDING SITE FOR RESIDUE EDO A 2 source : AC5 19) chain A residue 1291 type sequence M description BINDING SITE FOR RESIDUE EDO A 2 source : AC5 20) chain A residue 932 type sequence P description BINDING SITE FOR RESIDUE EDO A 3 source : AC6 21) chain A residue 933 type sequence K description BINDING SITE FOR RESIDUE EDO A 3 source : AC6 22) chain A residue 1204 type sequence N description BINDING SITE FOR RESIDUE EDO A 3 source : AC6 23) chain A residue 889 type sequence I description BINDING SITE FOR RESIDUE EDO A 4 source : AC7 24) chain A residue 890 type sequence Y description BINDING SITE FOR RESIDUE EDO A 4 source : AC7 25) chain A residue 891 type sequence P description BINDING SITE FOR RESIDUE EDO A 4 source : AC7 26) chain A residue 940 type sequence T description BINDING SITE FOR RESIDUE EDO A 4 source : AC7 27) chain A residue 1039 type sequence Q description BINDING SITE FOR RESIDUE EDO A 5 source : AC8 28) chain A residue 1040 type sequence A description BINDING SITE FOR RESIDUE EDO A 5 source : AC8 29) chain A residue 1233 type sequence W description BINDING SITE FOR RESIDUE EDO A 5 source : AC8 30) chain A residue 1030 type sequence T description BINDING SITE FOR RESIDUE EDO A 6 source : AC9 31) chain A residue 1034 type sequence K description BINDING SITE FOR RESIDUE EDO A 6 source : AC9 32) chain A residue 1035 type sequence Y description BINDING SITE FOR RESIDUE EDO A 6 source : AC9 33) chain A residue 1083 type sequence K description BINDING SITE FOR RESIDUE EDO A 6 source : AC9 34) chain A residue 1108 type sequence A description BINDING SITE FOR RESIDUE EDO A 7 source : BC1 35) chain A residue 1111 type sequence R description BINDING SITE FOR RESIDUE EDO A 7 source : BC1 36) chain A residue 961 type sequence T description BINDING SITE FOR RESIDUE EDO A 8 source : BC2 37) chain A residue 1221 type sequence N description BINDING SITE FOR RESIDUE EDO A 8 source : BC2 38) chain A residue 1222 type sequence A description BINDING SITE FOR RESIDUE EDO A 8 source : BC2 39) chain A residue 1245 type sequence T description BINDING SITE FOR RESIDUE EDO A 8 source : BC2 40) chain A residue 1247 type sequence C description BINDING SITE FOR RESIDUE EDO A 8 source : BC2 41) chain A residue 981 type sequence L description BINDING SITE FOR RESIDUE EDO A 9 source : BC3 42) chain A residue 982 type sequence G description BINDING SITE FOR RESIDUE EDO A 9 source : BC3 43) chain A residue 1159 type sequence I description BINDING SITE FOR RESIDUE EDO A 9 source : BC3 44) chain A residue 1322 type sequence R description BINDING SITE FOR RESIDUE CL A 1402 source : BC4 45) chain A residue 1114 type sequence S description BINDING SITE FOR RESIDUE CL A 1403 source : BC5 46) chain A residue 1115 type sequence A description BINDING SITE FOR RESIDUE CL A 1403 source : BC5 47) chain A residue 1148 type MOD_RES sequence E description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 48) chain A residue 1226 type MOD_RES sequence H description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 49) chain A residue 1331 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 50) chain A residue 1334 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 51) chain A residue 1358 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1 52) chain A residue 1361 type MOD_RES sequence C description Citrulline; alternate => ECO:0000269|PubMed:15345777, ECO:0000269|PubMed:16497732, ECO:0000269|PubMed:16567635 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links