eF-site ID 3at1-A PDB Code 3at1 Chain A click to enlarge Title CRYSTAL STRUCTURES OF PHOSPHONOACETAMIDE LIGATED T AND PHOSPHONOACETAMIDE AND MALONATE LIGATED R STATES OF ASPARTATE CARBAMOYLTRANSFERASE AT 2.8-ANGSTROMS RESOLUTION AND NEUTRAL PH Classification TRANSFERASE (CARBAMOYL-P,ASPARTATE) Compound ASPARTATE CARBAMOYLTRANSFERASE (T STATE), CATALYTIC CHAIN Source Escherichia coli (strain K12) (PYRI_ECOLI) Sequence A:  ANPLYQKHIISINDLSRDDLNLVLATAAKLKANPQPELLK HKVIASCFFEASTRTRLSFQTSMHRLGASVVGFSDSANTS LGKKGETLADTISVISTYVDAIVMRHPQEGAARLATEFSG NVPVLNAGDGSNQHPTQTLLDLFTIQQTEGRLDNLHVAMV GDLKYGRTVHSLTQALAKFDGNRFYFIAPDALAMPEYILD MLDEKGIAWSLHSSIEEVMAEVDILYMTRVQKERLDPSEY ANVKAQFVLRASDLHNAKANMKVLHPLPRVDEIATDVDKT PHAWYFQQAGNGIFARQALLALVLNRDLVL Description Functional site 1) chain A residue 54 type sequence R description PCT binding site source : PAA 2) chain A residue 55 type sequence T description PCT binding site source : PAA 3) chain A residue 105 type sequence R description PCT binding site source : PAA 4) chain A residue 134 type sequence H description PCT binding site source : PAA 5) chain A residue 137 type sequence Q description PCT binding site source : PAA 6) chain A residue 266 type sequence P description PCT binding site source : PAA 7) chain A residue 267 type sequence L description PCT binding site source : PAA 8) chain A residue 52 type sequence S description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 9) chain A residue 53 type sequence T description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 10) chain A residue 54 type sequence R description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 11) chain A residue 55 type sequence T description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 12) chain A residue 81 type sequence L description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 13) chain A residue 105 type sequence R description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 14) chain A residue 134 type sequence H description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 15) chain A residue 137 type sequence Q description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 16) chain A residue 266 type sequence P description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 17) chain A residue 267 type sequence L description BINDING SITE FOR RESIDUE PCT A 311 source : AC3 18) chain A residue 55 type catalytic sequence T description 405 source MCSA : MCSA1 19) chain A residue 56 type catalytic sequence R description 405 source MCSA : MCSA1 20) chain A residue 85 type catalytic sequence G description 405 source MCSA : MCSA1 21) chain A residue 106 type catalytic sequence H description 405 source MCSA : MCSA1 22) chain A residue 135 type catalytic sequence P description 405 source MCSA : MCSA1 23) chain A residue 48-55 type prosite sequence FFEASTRT description CARBAMOYLTRANSFERASE Aspartate and ornithine carbamoyltransferases signature. FfEaSTRT source prosite : PS00097 24) chain A residue 85 type BINDING sequence G description BINDING => ECO:0000255|HAMAP-Rule:MF_00001, ECO:0000305|PubMed:3380787 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 168 type BINDING sequence T description BINDING => ECO:0000255|HAMAP-Rule:MF_00001, ECO:0000305|PubMed:3380787 source Swiss-Prot : SWS_FT_FI2 26) chain A residue 230 type BINDING sequence V description BINDING => ECO:0000255|HAMAP-Rule:MF_00001, ECO:0000305|PubMed:3380787 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links