eF-site ID 3akm-ABCD PDB Code 3akm Chain A, B, C, D click to enlarge Title X-ray structure of iFABP from human and rat with bound fluorescent fatty acid analogue Classification TRANSPORT PROTEIN Compound Fatty acid-binding protein, intestinal Source Homo sapiens (Human) (FABPI_HUMAN) Sequence A:  AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTI TQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRG TWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYE GVEAKRIFKKD B:  AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTI TQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRG TWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYE GVEAKRIFKKD C:  AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTI TQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRG TWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYE GVEAKRIFKKD D:  AFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTI TQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRG TWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYE GVEAKRIFKKD Description Functional site 1) chain A residue 14 type sequence Y description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 2) chain A residue 17 type sequence F description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 3) chain A residue 18 type sequence M description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 4) chain A residue 21 type sequence M description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 5) chain A residue 23 type sequence V description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 6) chain A residue 31 type sequence A description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 7) chain A residue 51 type sequence E description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 8) chain A residue 55 type sequence F description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 9) chain A residue 62 type sequence F description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 10) chain A residue 72 type sequence L description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 11) chain A residue 73 type sequence A description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 12) chain A residue 74 type sequence D description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 13) chain A residue 78 type sequence L description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 14) chain A residue 82 type sequence W description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 15) chain A residue 93 type sequence F description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 16) chain A residue 106 type sequence R description BINDING SITE FOR RESIDUE 11D A 132 source : AC1 17) chain A residue 115 type sequence Q description BINDING SITE FOR RESIDUE MG A 133 source : AC2 18) chain B residue 14 type sequence Y description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 19) chain B residue 17 type sequence F description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 20) chain B residue 18 type sequence M description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 21) chain B residue 21 type sequence M description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 22) chain B residue 31 type sequence A description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 23) chain B residue 51 type sequence E description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 24) chain B residue 55 type sequence F description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 25) chain B residue 60 type sequence V description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 26) chain B residue 62 type sequence F description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 27) chain B residue 68 type sequence F description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 28) chain B residue 70 type sequence Y description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 29) chain B residue 72 type sequence L description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 30) chain B residue 73 type sequence A description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 31) chain B residue 74 type sequence D description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 32) chain B residue 82 type sequence W description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 33) chain B residue 93 type sequence F description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 34) chain B residue 106 type sequence R description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 35) chain B residue 117 type sequence Y description BINDING SITE FOR RESIDUE 11D B 132 source : AC3 36) chain B residue 115 type sequence Q description BINDING SITE FOR RESIDUE MG B 133 source : AC4 37) chain C residue 14 type sequence Y description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 38) chain C residue 17 type sequence F description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 39) chain C residue 18 type sequence M description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 40) chain C residue 21 type sequence M description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 41) chain C residue 23 type sequence V description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 42) chain C residue 27 type sequence K description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 43) chain C residue 31 type sequence A description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 44) chain C residue 49 type sequence V description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 45) chain C residue 51 type sequence E description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 46) chain C residue 70 type sequence Y description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 47) chain C residue 72 type sequence L description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 48) chain C residue 74 type sequence D description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 49) chain C residue 82 type sequence W description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 50) chain C residue 106 type sequence R description BINDING SITE FOR RESIDUE 11D C 132 source : AC5 51) chain C residue 115 type sequence Q description BINDING SITE FOR RESIDUE MG C 133 source : AC6 52) chain D residue 14 type sequence Y description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 53) chain D residue 17 type sequence F description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 54) chain D residue 18 type sequence M description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 55) chain D residue 21 type sequence M description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 56) chain D residue 23 type sequence V description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 57) chain D residue 31 type sequence A description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 58) chain D residue 49 type sequence V description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 59) chain D residue 51 type sequence E description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 60) chain D residue 55 type sequence F description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 61) chain D residue 62 type sequence F description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 62) chain D residue 70 type sequence Y description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 63) chain D residue 72 type sequence L description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 64) chain D residue 73 type sequence A description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 65) chain D residue 74 type sequence D description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 66) chain D residue 82 type sequence W description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 67) chain D residue 106 type sequence R description BINDING SITE FOR RESIDUE 11D D 132 source : AC7 68) chain D residue 115 type sequence Q description BINDING SITE FOR RESIDUE MG D 133 source : AC8 69) chain D residue 117 type sequence Y description BINDING SITE FOR RESIDUE MG D 133 source : AC8 70) chain A residue 1 type MOD_RES sequence A description N-acetylalanine => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI2 71) chain B residue 1 type MOD_RES sequence A description N-acetylalanine => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI2 72) chain C residue 1 type MOD_RES sequence A description N-acetylalanine => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI2 73) chain D residue 1 type MOD_RES sequence A description N-acetylalanine => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI2 74) chain A residue 82 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 75) chain A residue 106 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 76) chain B residue 82 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 77) chain B residue 106 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 78) chain C residue 82 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 79) chain C residue 106 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 80) chain D residue 82 type BINDING sequence W description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 81) chain D residue 106 type BINDING sequence R description BINDING => ECO:0000250|UniProtKB:P02693 source Swiss-Prot : SWS_FT_FI1 82) chain A residue 4-21 type prosite sequence STWKVDRSENYDKFMEKM description FABP Cytosolic fatty-acid binding proteins signature. STWkVdrSeNYDkFMEKM source prosite : PS00214

Display surface Download Links