eF-site ID 3aiz-A
PDB Code 3aiz
Chain A

click to enlarge
Title Crystal structure of PCNA2-PCNA3 complex from Sulfolobus tokodaii (P21212)
Classification REPLICATION
Compound DNA polymerase sliding clamp B
Source Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) (PCNA3_SULTO)
Sequence A:  MIKATYSSAKDFYSLLSGLLKVTDEIILNFTEDSIFSRYL
TDDKVLMVIFKIPKEYLEDYTIDKPLGIKININDLKKILG
KAKSKSATVTLEETEAGLKVTVRDEKTGTRSNIYIKGEKT
SIDQLTEPKVNLSVTFTTDGDVLKDIARDLSLVGEEVEIS
ADENTVTLSTEEAGRTYKSLLKQDKPLKSLNVESPSKAVY
SIEVLKDVFKVTSISQNVTVGFGNNIPMKIEVPTDSGGQL
IFWIAPRL
Description (1)  DNA polymerase sliding clamp B, DNA polymerase sliding clamp C


Functional site

1) chain A
residue 99
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 249
source : AC1

2) chain A
residue 103
type
ligand
sequence R
description BINDING SITE FOR RESIDUE SO4 A 249
source : AC1

3) chain A
residue 84
type
ligand
sequence S
description BINDING SITE FOR RESIDUE SO4 A 250
source : AC2

4) chain A
residue 85
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 250
source : AC2

5) chain A
residue 106
type
ligand
sequence K
description BINDING SITE FOR RESIDUE SO4 A 250
source : AC2


Display surface

Download
Links