eF-site ID 3ai5-A PDB Code 3ai5 Chain A click to enlarge Title Crystal structure of yeast enhanced green fluorescent protein-ubiquitin fusion protein Classification Fluorescent Protein, transcription Compound yeast enhanced green fluorescent protein,Ubiquitin Source Mus musculus (Mouse) (E9Q9J0_MOUSE) Sequence A:  SKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGK LTLKFICTTGKLPVPWPTLVTTFXVQCFARYPDHMKQHDF FKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRI ELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKV NFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLST QSALSKDPNEKRDHMVLLEFVTAAGITGSMQIFVKTLTGK TITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLE DGRTLSDYNIQKESTLHLVL Description Functional site 1) chain A residue 142 type sequence E description BINDING SITE FOR RESIDUE EDO A 315 source : AC1 2) chain A residue 143 type sequence Y description BINDING SITE FOR RESIDUE EDO A 315 source : AC1 3) chain A residue 202 type sequence S description BINDING SITE FOR RESIDUE EDO A 315 source : AC1 4) chain A residue 34 type sequence E description BINDING SITE FOR RESIDUE EDO A 316 source : AC2 5) chain A residue 36 type sequence D description BINDING SITE FOR RESIDUE EDO A 316 source : AC2 6) chain A residue 41 type sequence K description BINDING SITE FOR RESIDUE EDO A 316 source : AC2 7) chain A residue 43 type sequence T description BINDING SITE FOR RESIDUE EDO A 316 source : AC2 8) chain A residue 96 type sequence R description BINDING SITE FOR RESIDUE EDO A 317 source : AC3 9) chain A residue 97 type sequence T description BINDING SITE FOR RESIDUE EDO A 317 source : AC3 10) chain A residue 116 type sequence G description BINDING SITE FOR RESIDUE EDO A 317 source : AC3 11) chain A residue 117 type sequence D description BINDING SITE FOR RESIDUE EDO A 317 source : AC3 12) chain A residue 182 type sequence Y description BINDING SITE FOR RESIDUE EDO A 317 source : AC3 13) chain A residue 109 type sequence R description BINDING SITE FOR RESIDUE EDO A 318 source : AC4 14) chain A residue 111 type sequence E description BINDING SITE FOR RESIDUE EDO A 318 source : AC4 15) chain A residue 122 type sequence R description BINDING SITE FOR RESIDUE EDO A 318 source : AC4 16) chain A residue 124 type sequence E description BINDING SITE FOR RESIDUE EDO A 318 source : AC4 17) chain A residue 95 type sequence E description BINDING SITE FOR RESIDUE EDO A 319 source : AC5 18) chain A residue 96 type sequence R description BINDING SITE FOR RESIDUE EDO A 319 source : AC5 19) chain A residue 108 type sequence T description BINDING SITE FOR RESIDUE EDO A 319 source : AC5 20) chain A residue 261-286 type prosite sequence KIQDKEGIPPDQQRLIFAGKQLEDGR description UBIQUITIN_1 Ubiquitin domain signature. KakIqDkegIPpdqQrLIFaGkqleD source prosite : PS00299 21) chain A residue 300 type SITE sequence H description Essential for function source Swiss-Prot : SWS_FT_FI4 22) chain A residue 68 type MOD_RES sequence V description (Z)-2,3-didehydrotyrosine => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI1 23) chain A residue 66 type CROSSLNK sequence X description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 24) chain A residue 69 type CROSSLNK sequence Q description 5-imidazolinone (Ser-Gly) => ECO:0000269|PubMed:8448132 source Swiss-Prot : SWS_FT_FI2 25) chain A residue 286 type SITE sequence R description Interacts with activating enzyme source Swiss-Prot : SWS_FT_FI3 26) chain A residue 297 type MOD_RES sequence S description Phosphoserine; by PINK1 => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI5 27) chain A residue 243 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI6 28) chain A residue 259 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI6 29) chain A residue 261 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI6 30) chain A residue 265 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI6 31) chain A residue 280 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI6 32) chain A residue 295 type CROSSLNK sequence K description Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) => ECO:0000250|UniProtKB:P62987 source Swiss-Prot : SWS_FT_FI6

Display surface Download Links