eF-site ID 3aec-D PDB Code 3aec Chain D click to enlarge Title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid Classification OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Compound Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial Source ORGANISM_COMMON: Pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence D:  SSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLAA ALTLHGHWGIGQVVTDYVRGDALQKAAKAGLLALSAFTFA GLCYFNYHDVGICKAVAMLWKL Description Functional site 1) chain D residue 53 type sequence L description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 2) chain D residue 57 type sequence L description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 3) chain D residue 79 type sequence H description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 4) chain D residue 83 type sequence G description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 5) chain D residue 60 type sequence A description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 6) chain D residue 61 type sequence Y description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 7) chain D residue 62 type sequence L description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 8) chain D residue 64 type sequence P description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 9) chain D residue 127 type sequence C description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 10) chain D residue 131 type sequence A description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 11) chain D residue 134 type sequence W description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 12) chain D residue 90 type sequence D description BINDING SITE FOR RESIDUE EBM C 1201 source : AC7 13) chain D residue 91 type sequence Y description BINDING SITE FOR RESIDUE EBM C 1201 source : AC7 14) chain D residue 63-67 type TOPO_DOM sequence NPCSA description Mitochondrial intermembrane => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 15) chain D residue 120-136 type TOPO_DOM sequence NYHDVGICKAVAMLWKL description Mitochondrial intermembrane => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 16) chain D residue 89-97 type TOPO_DOM sequence TDYVRGDAL description Mitochondrial matrix => ECO:0000305 source Swiss-Prot : SWS_FT_FI3 17) chain D residue 91 type BINDING sequence Y description BINDING => ECO:0000269|PubMed:15989954 source Swiss-Prot : SWS_FT_FI5 18) chain D residue 41-62 type TRANSMEM sequence LHWTGERVVSVLLLGLLPAAYL description Helical source Swiss-Prot : SWS_FT_FI1 19) chain D residue 68-88 type TRANSMEM sequence MDYSLAAALTLHGHWGIGQVV description Helical source Swiss-Prot : SWS_FT_FI1 20) chain D residue 98-119 type TRANSMEM sequence QKAAKAGLLALSAFTFAGLCYF description Helical source Swiss-Prot : SWS_FT_FI1 21) chain D residue 79 type BINDING sequence H description axial binding residue => ECO:0000269|PubMed:15989954, ECO:0007744|PDB:1ZOY, ECO:0007744|PDB:1ZP0 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links