eF-site ID 3aec-C PDB Code 3aec Chain C click to enlarge Title Crystal structure of porcine heart mitochondrial complex II bound with 2-Iodo-N-(1-methylethyl)-benzamid Classification OXIDOREDUCTASE/OXIDOREDUCTASE INHIBITOR Compound Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial Source ORGANISM_COMMON: Pig; ORGANISM_SCIENTIFIC: Sus scrofa; Sequence C:  TTAKEEMERFWNKNLGSNRPLSPHITIYRWSLPMAMSICH RGTGIALSAGVSLFGLSALLLPGNFESHLELVKSLCLGPT LIYTAKFGIVFPLMYHTWNGIRHLIWDLGKGLTIPQLTQS GVVVLILTVLSSVGLAAM Description Functional site 1) chain C residue 45 type sequence H description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 2) chain C residue 46 type sequence R description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 3) chain C residue 49 type sequence G description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 4) chain C residue 52 type sequence L description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 5) chain C residue 53 type sequence S description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 6) chain C residue 101 type sequence H description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 7) chain C residue 108 type sequence H description BINDING SITE FOR RESIDUE HEM C 1305 source : AC5 8) chain C residue 140 type sequence L description BINDING SITE FOR RESIDUE EPH D 1306 source : AC6 9) chain C residue 42 type sequence S description BINDING SITE FOR RESIDUE EBM C 1201 source : AC7 10) chain C residue 46 type sequence R description BINDING SITE FOR RESIDUE EBM C 1201 source : AC7 11) chain C residue 24-48 type prosite sequence RPLSPHITIYRWSLPMAMSICHRGT description SDH_CYT_1 Succinate dehydrogenase cytochrome b subunit signature 1. RPLsphItiyrwsLpmamSicHRgT source prosite : PS01000 12) chain C residue 101-114 type prosite sequence HTWNGIRHLIWDLG description SDH_CYT_2 Succinate dehydrogenase cytochrome b subunit signature 2. HtwnGIRHLiWDlG source prosite : PS01001 13) chain C residue 119-140 type TOPO_DOM sequence IPQLTQSGVVVLILTVLSSVGL description Mitochondrial intermembrane => ECO:0000305 source Swiss-Prot : SWS_FT_FI2 14) chain C residue 141-143 type TOPO_DOM sequence AAM description Mitochondrial matrix => ECO:0000305 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links