eF-site ID 3a4l-A PDB Code 3a4l Chain A click to enlarge Title Crystal structure of archaeal O-phosphoseryl-tRNA(Sec) kinase Classification TRANSFERASE Compound L-seryl-tRNA(Sec) kinase Source null (PSTK_METJA) Sequence A:  DIMLIILTGLPGVGKSTFSKNLAKILSKNNIDVIVLGSDL IRESFPVWKEKYEEFIKKSTYRLIDSALKNYWVIVDDTNY YNSMRRDLINIAKKYNKNYAIIYLKASLDVLIRRNIERGE KIPNEVIKKMYEKFDEPGKKYKWDEPFLIIDTTKDIDFNE IAKKLIEKSKEIPKFNISDKIDKETRKIVSEYIKSKKLDK DKIKEVVELRKEFLKKIKKVDADRVLKEFKDLLNSY Description Functional site 1) chain A residue 13 type sequence P description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 2) chain A residue 14 type sequence G description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 3) chain A residue 15 type sequence V description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 4) chain A residue 16 type sequence G description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 5) chain A residue 17 type sequence K description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 6) chain A residue 18 type sequence S description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 7) chain A residue 19 type sequence T description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 8) chain A residue 116 type sequence R description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 9) chain A residue 120 type sequence R description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 10) chain A residue 154 type sequence T description BINDING SITE FOR RESIDUE ANP A 301 source : AC1 11) chain A residue 18 type sequence S description BINDING SITE FOR RESIDUE MG A 401 source : AC2 12) chain A residue 223 type sequence R description BINDING SITE FOR RESIDUE IOD A 402 source : AC3 13) chain A residue 143 type sequence Y description BINDING SITE FOR RESIDUE EDO A 261 source : AC4 14) chain A residue 144 type sequence K description BINDING SITE FOR RESIDUE EDO A 261 source : AC4 15) chain A residue 145 type sequence W description BINDING SITE FOR RESIDUE EDO A 261 source : AC4 16) chain A residue 45 type sequence E description BINDING SITE FOR RESIDUE EDO A 262 source : AC5 17) chain A residue 46 type sequence S description BINDING SITE FOR RESIDUE EDO A 262 source : AC5 18) chain A residue 48 type sequence P description BINDING SITE FOR RESIDUE EDO A 262 source : AC5 19) chain A residue 228 type sequence K description BINDING SITE FOR RESIDUE EDO B 261 source : AC8 20) chain A residue 232 type sequence K description BINDING SITE FOR RESIDUE EDO B 261 source : AC8 21) chain A residue 22 type sequence K description BINDING SITE FOR RESIDUE EDO B 262 source : AC9 22) chain A residue 11 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI1

Display surface Download Links