eF-site ID 3a1d-A PDB Code 3a1d Chain A click to enlarge Title Crystal structure of the P- and N-domains of CopA, a copper-transporting P-type ATPase, bound with ADP-Mg Classification HYDROLASE Compound Probable copper-exporting P-type ATPase A Source Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) (COPA_ARCFU) Sequence A:  AELGILIKNADALEVAEKVTAVIFDKTGTLTKGKPEVTDL VPLNGDERELLRLAAIAERRSEHPIAEAIVKKALEHGIEL GEPEKVEVIAGEGVVADGILVGNKRLMEDFGVAVSNEVEL ALEKLEREAKTAVIVARNGRVEGIIAVSDTLKESAKPAVQ ELKRMGIKVGMITGDNWRSAEAISRELNLDLVIAEVLPHQ KSEEVKKLQAKEVVAFVGDGINDAPALAQADLGIAVGSGS DVAVESGDIVLIRDDLRDVVAAIQLSRK Description Functional site 1) chain A residue 426 type sequence T description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 2) chain A residue 457 type sequence E description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 3) chain A residue 460 type sequence S description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 4) chain A residue 462 type sequence H description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 5) chain A residue 464 type sequence I description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 6) chain A residue 490 type sequence G description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 7) chain A residue 491 type sequence E description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 8) chain A residue 492 type sequence G description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 9) chain A residue 493 type sequence V description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 10) chain A residue 500 type sequence V description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 11) chain A residue 501 type sequence G description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 12) chain A residue 502 type sequence N description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 13) chain A residue 572 type sequence T description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 14) chain A residue 573 type sequence G description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 15) chain A residue 574 type sequence D description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 16) chain A residue 597 type sequence P description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 17) chain A residue 600 type sequence K description BINDING SITE FOR RESIDUE ADP A 997 source : AC1 18) chain A residue 424-430 type prosite sequence DKTGTLT description ATPASE_E1_E2 E1-E2 ATPases phosphorylation site. DKTGTLT source prosite : PS00154 19) chain A residue 424 type ACT_SITE sequence D description 4-aspartylphosphate intermediate => ECO:0000250 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 457 type BINDING sequence E description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 21) chain A residue 490 type BINDING sequence G description BINDING => ECO:0000255 source Swiss-Prot : SWS_FT_FI2 22) chain A residue 618 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3 23) chain A residue 622 type BINDING sequence D description source Swiss-Prot : SWS_FT_FI3

Display surface Download Links