eF-site ID 3a1a-A PDB Code 3a1a Chain A click to enlarge Title Crystal Structure of the DNMT3A ADD domain Classification TRANSFERASE Compound DNA (cytosine-5)-methyltransferase 3A Source Homo sapiens (Human) (DNM3A_HUMAN) Sequence A:  GSRERLVYEVRQKCRNIEDICISCGSLNVTLEHPLFVGGM CQNCKNCFLECAYQYDDDGYQSYCTICCGGREVLMCGNNN CCRCFCVECVDLLVGPGAAQAAIWNCYMCGHKGTYGLLRR REDWPSRLQMFF Description Functional site 1) chain A residue 494 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 497 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 514 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 517 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 537 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 6) chain A residue 540 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 7) chain A residue 559 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 8) chain A residue 562 type sequence C description BINDING SITE FOR RESIDUE ZN A 2 source : AC2 9) chain A residue 549 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 10) chain A residue 554 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 11) chain A residue 583 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 12) chain A residue 586 type sequence C description BINDING SITE FOR RESIDUE ZN A 3 source : AC3 13) chain A residue 521 type sequence F description BINDING SITE FOR RESIDUE EDO A 4 source : AC4 14) chain A residue 524 type sequence C description BINDING SITE FOR RESIDUE EDO A 4 source : AC4 15) chain A residue 525 type sequence A description BINDING SITE FOR RESIDUE EDO A 4 source : AC4 16) chain A residue 536 type sequence Y description BINDING SITE FOR RESIDUE EDO A 4 source : AC4 17) chain A residue 537 type sequence C description BINDING SITE FOR RESIDUE EDO A 4 source : AC4 18) chain A residue 541 type sequence C description BINDING SITE FOR RESIDUE EDO A 4 source : AC4 19) chain A residue 493-523 type ZN_FING sequence ICISCGSLNVTLEHPLFVGGMCQNCKNCFLE description GATA-type; atypical => ECO:0000255|PROSITE-ProRule:PRU00865 source Swiss-Prot : SWS_FT_FI1 20) chain A residue 534-590 type ZN_FING sequence QSYCTICCGGREVLMCGNNNCCRCFCVECVDLLVGPGAAQ AAIWNCYMCGHKG description PHD-type; atypical => ECO:0000255|PROSITE-ProRule:PRU00865 source Swiss-Prot : SWS_FT_FI2

Display surface Download Links