eF-site ID 3a0b-h PDB Code 3a0b Chain h click to enlarge Title Crystal structure of Br-substituted Photosystem II complex Classification ELECTRON TRANSPORT Compound Photosystem Q(B) protein Source ORGANISM_COMMON: Synechococcus vulcanus; ORGANISM_SCIENTIFIC: Thermosynechococcus vulcanus; Sequence h:  ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVF LLIILEIYNSTLILDGVNVSWKAL Description Functional site 1) chain h residue 5035 type sequence M description BINDING SITE FOR RESIDUE CLA d 6008 source : IC1 2) chain h residue 5037 type sequence L description BINDING SITE FOR RESIDUE CLA b 6009 source : IC2 3) chain h residue 5045 type sequence I description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 4) chain h residue 5046 type sequence L description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 5) chain h residue 5049 type sequence Y description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 6) chain h residue 5038 type sequence F description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 7) chain h residue 5039 type sequence L description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 8) chain h residue 5043 type sequence L description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 9) chain h residue 5046 type sequence L description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 10) chain h residue 5027 type sequence T description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 11) chain h residue 5030 type sequence L description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 12) chain h residue 5031 type sequence M description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 13) chain h residue 5034 type sequence F description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 14) chain h residue 5035 type sequence M description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 15) chain h residue 5039 type sequence L description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 16) chain h residue 5007 type sequence L description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 17) chain h residue 5005 type sequence T description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 18) chain h residue 5007 type sequence L description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 19) chain h residue 5008 type sequence G description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 20) chain h residue 5034 type sequence F description BINDING SITE FOR RESIDUE BCR h 6049 source : MC6 21) chain h residue 5035 type sequence M description BINDING SITE FOR RESIDUE BCR h 6049 source : MC6 22) chain h residue 5037 type sequence L description BINDING SITE FOR RESIDUE BCR h 6049 source : MC6 23) chain h residue 5038 type sequence F description BINDING SITE FOR RESIDUE BCR h 6049 source : MC6 24) chain h residue 5041 type sequence F description BINDING SITE FOR RESIDUE BCR h 6049 source : MC6 25) chain h residue 5049 type sequence Y description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 26) chain h residue 5050 type sequence N description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 27) chain h residue 5060 type sequence V description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 28) chain h residue 5061 type sequence S description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 29) chain h residue 5062 type sequence W description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6

Display surface Download Links