eF-site ID 3a0b-b PDB Code 3a0b Chain b click to enlarge Title Crystal structure of Br-substituted Photosystem II complex Classification ELECTRON TRANSPORT Compound Photosystem Q(B) protein Source ORGANISM_COMMON: Synechococcus vulcanus; ORGANISM_SCIENTIFIC: Thermosynechococcus vulcanus; Sequence b:  WYRVHTVLINDPGRLIAAHLMHTALVAGWAGSMALYELAT FDPSDPVLNPMWRQGMFVLPFMARLGVTGSWSGWSITGET GIDPGFWSFEGVALAHIVLSGLLFLAACWHWVYWDLELFR DPRTGEPALDLPKMFGIHLFLAGLLCFGFGAFHLTGLFGP GMWVSDPYGLTGSVQPVAPEWGPDGFNPYNPGGVVAHHIA AGIVGIIAGLFHILVRPPQRLYKALRMGNIETVLSSSIAA VFFAAFVVAGTMWYGSATTPIELFGPTRYQWDSSYFQQEI NRRVQASLASGATLEEAWSAIPEKLAFYDYIGNNPAKGGL FRTGPMNKGDGIAQAWKGHAVFRNKEGEELFVRRMPAFFE SFPVILTDKNGVVKADIPFRRAESKYSFEQQGVTVSFYGG ELNGQTFTDPPTVKSYARKAIFGEIFEFDTETLNSDGIFR TSPRGWFTFAHAVFALLFFFGHIWHGARTLFRDVFSGIDP ELSPE Description Functional site 1) chain b residue 5187 type sequence F description BINDING SITE FOR RESIDUE CLA b 6009 source : IC2 2) chain b residue 5186 type sequence G description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 3) chain b residue 5187 type sequence F description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 4) chain b residue 5194 type sequence G description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 5) chain b residue 5198 type sequence H description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 6) chain b residue 5202 type sequence A description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 7) chain b residue 5244 type sequence F description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 8) chain b residue 5247 type sequence F description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 9) chain b residue 5248 type sequence V description BINDING SITE FOR RESIDUE CLA b 6010 source : IC3 10) chain b residue 5065 type sequence R description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 11) chain b residue 5066 type sequence L description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 12) chain b residue 5143 type sequence A description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 13) chain b residue 5146 type sequence L description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 14) chain b residue 5147 type sequence C description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 15) chain b residue 5195 type sequence V description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 16) chain b residue 5198 type sequence H description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 17) chain b residue 5199 type sequence H description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 18) chain b residue 5245 type sequence A description BINDING SITE FOR RESIDUE CLA b 6011 source : IC4 19) chain b residue 5030 type sequence W description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 20) chain b residue 5062 type sequence F description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 21) chain b residue 5065 type sequence R description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 22) chain b residue 5145 type sequence L description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 23) chain b residue 5146 type sequence L description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 24) chain b residue 5246 type sequence A description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 25) chain b residue 5249 type sequence V description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 26) chain b residue 5448 type sequence F description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 27) chain b residue 5455 type sequence F description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 28) chain b residue 5459 type sequence F description BINDING SITE FOR RESIDUE CLA b 6012 source : IC5 29) chain b residue 5024 type sequence T description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 30) chain b residue 5027 type sequence V description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 31) chain b residue 5028 type sequence A description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 32) chain b residue 5030 type sequence W description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 33) chain b residue 5031 type sequence A description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 34) chain b residue 5059 type sequence V description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 35) chain b residue 5063 type sequence M description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 36) chain b residue 5066 type sequence L description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 37) chain b residue 5093 type sequence V description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 38) chain b residue 5097 type sequence H description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 39) chain b residue 5202 type sequence A description BINDING SITE FOR RESIDUE CLA b 6013 source : IC6 40) chain b residue 5088 type sequence W description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 41) chain b residue 5096 type sequence A description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 42) chain b residue 5099 type sequence V description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 43) chain b residue 5100 type sequence L description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 44) chain b residue 5146 type sequence L description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 45) chain b residue 5149 type sequence G description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 46) chain b residue 5150 type sequence F description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 47) chain b residue 5153 type sequence F description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 48) chain b residue 5154 type sequence H description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 49) chain b residue 5159 type sequence F description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 50) chain b residue 5160 type sequence G description BINDING SITE FOR RESIDUE CLA b 6014 source : IC7 51) chain b residue 5030 type sequence W description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 52) chain b residue 5034 type sequence M description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 53) chain b residue 5037 type sequence Y description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 54) chain b residue 5056 type sequence G description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 55) chain b residue 5058 type sequence F description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 56) chain b residue 5326 type sequence P description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 57) chain b residue 5447 type sequence W description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 58) chain b residue 5448 type sequence F description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 59) chain b residue 5451 type sequence A description BINDING SITE FOR RESIDUE CLA b 6015 source : IC8 60) chain b residue 5233 type sequence T description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 61) chain b residue 5237 type sequence S description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 62) chain b residue 5240 type sequence A description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 63) chain b residue 5460 type sequence F description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 64) chain b residue 5463 type sequence H description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 65) chain b residue 5464 type sequence I description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 66) chain b residue 5467 type sequence G description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 67) chain b residue 5470 type sequence T description BINDING SITE FOR RESIDUE CLA b 6016 source : IC9 68) chain b residue 5136 type sequence F description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 69) chain b residue 5209 type sequence A description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 70) chain b residue 5212 type sequence F description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 71) chain b residue 5213 type sequence H description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 72) chain b residue 5218 type sequence P description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 73) chain b residue 5219 type sequence P description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 74) chain b residue 5222 type sequence L description BINDING SITE FOR RESIDUE CLA b 6017 source : JC1 75) chain b residue 5020 type sequence H description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 76) chain b residue 5132 type sequence L description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 77) chain b residue 5133 type sequence P description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 78) chain b residue 5136 type sequence F description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 79) chain b residue 5139 type sequence H description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 80) chain b residue 5226 type sequence L description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 81) chain b residue 5228 type sequence M description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 82) chain b residue 5231 type sequence I description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 83) chain b residue 5234 type sequence V description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 84) chain b residue 5237 type sequence S description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 85) chain b residue 5238 type sequence S description BINDING SITE FOR RESIDUE CLA b 6018 source : JC2 86) chain b residue 5002 type sequence W description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 87) chain b residue 5003 type sequence Y description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 88) chain b residue 5004 type sequence R description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 89) chain b residue 5006 type sequence H description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 90) chain b residue 5458 type sequence L description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 91) chain b residue 5459 type sequence F description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 92) chain b residue 5461 type sequence F description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 93) chain b residue 5462 type sequence G description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 94) chain b residue 5465 type sequence W description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 95) chain b residue 5466 type sequence H description BINDING SITE FOR RESIDUE CLA b 6019 source : JC3 96) chain b residue 5006 type sequence H description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 97) chain b residue 5016 type sequence L description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 98) chain b residue 5020 type sequence H description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 99) chain b residue 5023 type sequence H description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 100) chain b residue 5024 type sequence T description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 101) chain b residue 5027 type sequence V description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 102) chain b residue 5234 type sequence V description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 103) chain b residue 5235 type sequence L description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 104) chain b residue 5238 type sequence S description BINDING SITE FOR RESIDUE CLA b 6020 source : JC4 105) chain b residue 5006 type sequence H description BINDING SITE FOR RESIDUE CLA b 6021 source : JC5 106) chain b residue 5023 type sequence H description BINDING SITE FOR RESIDUE CLA b 6021 source : JC5 107) chain b residue 5030 type sequence W description BINDING SITE FOR RESIDUE CLA b 6021 source : JC5 108) chain b residue 5458 type sequence L description BINDING SITE FOR RESIDUE CLA b 6021 source : JC5 109) chain b residue 5459 type sequence F description BINDING SITE FOR RESIDUE CLA b 6021 source : JC5 110) chain b residue 5005 type sequence V description BINDING SITE FOR RESIDUE CLA b 6022 source : JC6 111) chain b residue 5006 type sequence H description BINDING SITE FOR RESIDUE CLA b 6022 source : JC6 112) chain b residue 5019 type sequence A description BINDING SITE FOR RESIDUE CLA b 6022 source : JC6 113) chain b residue 5023 type sequence H description BINDING SITE FOR RESIDUE CLA b 6022 source : JC6 114) chain b residue 5026 type sequence L description BINDING SITE FOR RESIDUE CLA b 6022 source : JC6 115) chain b residue 5017 type sequence I description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 116) chain b residue 5020 type sequence H description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 117) chain b residue 5130 type sequence L description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 118) chain b residue 5135 type sequence M description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 119) chain b residue 5138 type sequence I description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 120) chain b residue 5139 type sequence H description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 121) chain b residue 5142 type sequence L description BINDING SITE FOR RESIDUE CLA b 6023 source : JC7 122) chain b residue 5107 type sequence A description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 123) chain b residue 5110 type sequence W description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 124) chain b residue 5111 type sequence H description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 125) chain b residue 5119 type sequence L description BINDING SITE FOR RESIDUE CLA b 6024 source : JC8 126) chain b residue 5022 type sequence M description BINDING SITE FOR RESIDUE BCR b 6045 source : MC2 127) chain b residue 5026 type sequence L description BINDING SITE FOR RESIDUE BCR b 6045 source : MC2 128) chain b residue 5033 type sequence S description BINDING SITE FOR RESIDUE BCR T 6046 source : MC3 129) chain b residue 5034 type sequence M description BINDING SITE FOR RESIDUE BCR T 6046 source : MC3 130) chain b residue 5026 type sequence L description BINDING SITE FOR RESIDUE BCR b 6047 source : MC4 131) chain b residue 5029 type sequence G description BINDING SITE FOR RESIDUE BCR b 6047 source : MC4 132) chain b residue 5030 type sequence W description BINDING SITE FOR RESIDUE BCR b 6047 source : MC4 133) chain b residue 5098 type sequence I description BINDING SITE FOR RESIDUE BCR b 6047 source : MC4 134) chain b residue 5101 type sequence S description BINDING SITE FOR RESIDUE BCR b 6047 source : MC4 135) chain b residue 5102 type sequence G description BINDING SITE FOR RESIDUE BCR b 6047 source : MC4 136) chain b residue 5103 type sequence L description BINDING SITE FOR RESIDUE BCR b 6048 source : MC5 137) chain b residue 5104 type sequence L description BINDING SITE FOR RESIDUE BCR b 6048 source : MC5 138) chain b residue 5107 type sequence A description BINDING SITE FOR RESIDUE BCR b 6048 source : MC5 139) chain b residue 5109 type sequence C description BINDING SITE FOR RESIDUE BCR b 6048 source : MC5 140) chain b residue 5110 type sequence W description BINDING SITE FOR RESIDUE BCR b 6048 source : MC5 141) chain b residue 5247 type sequence F description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 142) chain b residue 5248 type sequence V description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 143) chain b residue 5250 type sequence A description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 144) chain b residue 5251 type sequence G description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 145) chain b residue 5255 type sequence Y description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 146) chain b residue 5270 type sequence Y description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 147) chain b residue 5453 type sequence A description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 148) chain b residue 5457 type sequence L description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 149) chain b residue 5460 type sequence F description BINDING SITE FOR RESIDUE DGD h 6058 source : NC6 150) chain b residue 5002 type sequence W description BINDING SITE FOR RESIDUE MGE b 6060 source : NC8 151) chain b residue 5004 type sequence R description BINDING SITE FOR RESIDUE MGE b 6060 source : NC8 152) chain b residue 5461 type sequence F description BINDING SITE FOR RESIDUE MGE b 6060 source : NC8 153) chain b residue 5465 type sequence W description BINDING SITE FOR RESIDUE MGE b 6060 source : NC8 154) chain b residue 5002 type sequence W description BINDING SITE FOR RESIDUE MGE d 6061 source : NC9 155) chain b residue 5200-5215 type TRANSMEM sequence IAAGIVGIIAGLFHIL description Helical => ECO:0000269|PubMed:21499260 source Swiss-Prot : SWS_FT_FI2 156) chain b residue 5234-5249 type TRANSMEM sequence VLSSSIAAVFFAAFVV description Helical => ECO:0000269|PubMed:21499260 source Swiss-Prot : SWS_FT_FI2 157) chain b residue 5454-5469 type TRANSMEM sequence VFALLFFFGHIWHGAR description Helical => ECO:0000269|PubMed:21499260 source Swiss-Prot : SWS_FT_FI2 158) chain b residue 5018-5033 type TRANSMEM sequence AAHLMHTALVAGWAGS description Helical => ECO:0000269|PubMed:21499260 source Swiss-Prot : SWS_FT_FI2 159) chain b residue 5098-5112 type TRANSMEM sequence IVLSGLLFLAACWHW description Helical => ECO:0000269|PubMed:21499260 source Swiss-Prot : SWS_FT_FI2 160) chain b residue 5137-5153 type TRANSMEM sequence GIHLFLAGLLCFGFGAF description Helical => ECO:0000269|PubMed:21499260 source Swiss-Prot : SWS_FT_FI2 161) chain b residue 5213 type MOD_RES sequence H description Blocked amino end (Met) => ECO:0000269|PubMed:2503398 source Swiss-Prot : SWS_FT_FI4 162) chain b residue 5452 type MOD_RES sequence H description Blocked amino end (Met) => ECO:0000269|PubMed:2503398 source Swiss-Prot : SWS_FT_FI4 163) chain b residue 5463 type MOD_RES sequence H description Blocked amino end (Met) => ECO:0000269|PubMed:2503398 source Swiss-Prot : SWS_FT_FI4 164) chain b residue 5466 type MOD_RES sequence H description Blocked amino end (Met) => ECO:0000269|PubMed:2503398 source Swiss-Prot : SWS_FT_FI4

Display surface Download Links