eF-site ID 2znv-A PDB Code 2znv Chain A click to enlarge Title Crystal structure of human AMSH-LP DUB domain in complex with Lys63-linked ubiquitin dimer Classification HYDROLASE/Signaling Protein Compound AMSH-like protease Source Homo sapiens (Human) (UBIQ_MOUSE) Sequence A:  GLRCVVLPEDLCHKFLQLAESNTVRGIATCGILCGKLTHN EFTITHVIVPKQSAGPDYCDMENVEELFNVQDQHDLLTLG WIHTHPTQTAFLSSVDLHTHCSYQLMLPEAIAIVCSPKHK DTGIFRLTNAGMLEVSACKKKGFHPHTKEPRLFSICKHVL VKDIKIIVLDLR Description Functional site 1) chain A residue 362 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 2) chain A residue 402 type sequence C description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 3) chain A residue 408 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 4) chain A residue 410 type sequence H description BINDING SITE FOR RESIDUE ZN A 1 source : AC1 5) chain A residue 362 type sequence H description BINDING SITE FOR RESIDUE EDO A 2 source : AC3 6) chain A residue 366 type sequence S description BINDING SITE FOR RESIDUE EDO A 2 source : AC3 7) chain A residue 400 type sequence S description BINDING SITE FOR RESIDUE EDO A 2 source : AC3 8) chain A residue 408 type SITE sequence H description Essential for function source Swiss-Prot : SWS_FT_FI2 9) chain A residue 410 type SITE sequence H description Essential for function source Swiss-Prot : SWS_FT_FI2

Display surface Download Links