eF-site ID 2zhg-A PDB Code 2zhg Chain A click to enlarge Title Crystal structure of SoxR in complex with DNA Classification TRANSCRIPTION/DNA Compound DNA (5'-D(*DGP*DCP*DCP*DTP*DCP*DAP*DAP*DGP*DTP*DTP*DAP*DAP*DCP*DTP*DTP*DGP*DAP*DGP*DGP*DC)-3') Source Escherichia coli (strain K12) (2ZHG) Sequence A:  ALLTPGEVAKRSGVAVSALHFYESKGLITSIRNSGNQRRY KRDVLRYVAIIKIAQRIGIPLATIGEAFGVTLSAKEWKQL SSQWREELDRRIHTLVALRDELDGCIGCGCLSRSDCPLRN P Description Functional site 1) chain A residue 119 type sequence C description BINDING SITE FOR RESIDUE FES A 501 source : AC1 2) chain A residue 122 type sequence C description BINDING SITE FOR RESIDUE FES A 501 source : AC1 3) chain A residue 123 type sequence G description BINDING SITE FOR RESIDUE FES A 501 source : AC1 4) chain A residue 124 type sequence C description BINDING SITE FOR RESIDUE FES A 501 source : AC1 5) chain A residue 125 type sequence L description BINDING SITE FOR RESIDUE FES A 501 source : AC1 6) chain A residue 130 type sequence C description BINDING SITE FOR RESIDUE FES A 501 source : AC1 7) chain A residue 107 type sequence H description BINDING SITE FOR RESIDUE DTT A 901 source : AC2 8) chain A residue 20 type sequence R description BINDING SITE FOR RESIDUE GOL A 801 source : AC3 9) chain A residue 54 type sequence L description BINDING SITE FOR RESIDUE GOL A 801 source : AC3 10) chain A residue 127 type sequence R description BINDING SITE FOR RESIDUE GOL A 801 source : AC3 11) chain A residue 133 type sequence R description BINDING SITE FOR RESIDUE GOL A 801 source : AC3 12) chain A residue 14-33 type DNA_BIND sequence PGEVAKRSGVAVSALHFYES description H-T-H motif => ECO:0000255|PROSITE-ProRule:PRU00254 source Swiss-Prot : SWS_FT_FI1 13) chain A residue 119 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 14) chain A residue 122 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 15) chain A residue 124 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 16) chain A residue 130 type BINDING sequence C description source Swiss-Prot : SWS_FT_FI2 17) chain A residue 15-37 type prosite sequence GEVAKRSGVAVSALHFYESKGLI description HTH_MERR_1 MerR-type HTH domain signature. GeVAkrSGVAvsaLHfYEsk.GLI source prosite : PS00552

Display surface Download Links