eF-site ID 2zaj_7-A
PDB Code 2zaj
Model 7
Chain A

click to enlarge
Title Solution structure of the short-isoform of the second WW domain from the human membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 (MAGI-1)
Classification PROTEIN BINDING
Compound Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
Source Homo sapiens (Human) (MAGI1_HUMAN)
Sequence A:  GSSGSSGLDSELELPAGWEKIEDPVYGIYYVDHINRKTQY
ENPSGPSSG
Description (1)  Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1


Functional site

1) chain A
residue 18-43
type prosite
ligand
sequence WEKIEDPVYGIYYVDHINRKTQYENP
description WW/rsp5/WWP domain signature. W-x(9,11)-[VFY]-[FYW]-x(6,7)-[GSTNE]-[GSTQCR]-[FYW]-{R}-{SA}-P
source prosite : PS01159


Display surface

Download
Links