eF-site ID 2z9y-A PDB Code 2z9y Chain A click to enlarge Title Crystal structure of CERT START domain in complex with C10-diacylglycerol Classification LIPID TRANSPORT Compound Lipid-transfer protein CERT Source (Q53YV2_HUMAN) Sequence A:  GTHRFVQKVEEMVQNHMTYSLQDVGGDANWQLVVEEGEMK VYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVR NDWETTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLY LSVIRKIPPETWIVCNFSVDHDSAPLNNRCVRAKINVAMI CQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPASVL RAVAKREYPKFLKRFTSYVQEKTAGKPILF Description Functional site 1) chain A residue 436 type sequence F description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 2) chain A residue 442 type sequence R description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 3) chain A residue 445 type sequence W description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 4) chain A residue 467 type sequence Q description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 5) chain A residue 469 type sequence H description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 6) chain A residue 478 type sequence R description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 7) chain A residue 482 type sequence Y description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 8) chain A residue 504 type sequence N description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 9) chain A residue 523 type sequence I description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 10) chain A residue 553 type sequence Y description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 11) chain A residue 575 type sequence E description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 12) chain A residue 579 type sequence F description BINDING SITE FOR RESIDUE DDR A 1 source : AC1 13) chain A residue 472 type BINDING sequence V description BINDING => ECO:0000269|PubMed:18184806, ECO:0000269|PubMed:20036255 source Swiss-Prot : SWS_FT_FI1 14) chain A residue 530 type BINDING sequence Q description BINDING => ECO:0000269|PubMed:18184806, ECO:0000269|PubMed:20036255 source Swiss-Prot : SWS_FT_FI1 15) chain A residue 579 type BINDING sequence F description BINDING => ECO:0000269|PubMed:18184806, ECO:0000269|PubMed:20036255 source Swiss-Prot : SWS_FT_FI1 16) chain A residue 372 type MOD_RES sequence E description Phosphotyrosine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI2 17) chain A residue 377 type MOD_RES sequence N description Phosphoserine => ECO:0007744|PubMed:18669648 source Swiss-Prot : SWS_FT_FI4 18) chain A residue 373 type MOD_RES sequence E description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3 19) chain A residue 380 type MOD_RES sequence T description Phosphoserine => ECO:0007744|PubMed:23186163 source Swiss-Prot : SWS_FT_FI3

Display surface Download Links